Recombinant Eucalyptus globulus subsp. globulus Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is expressed in Escherichia coli systems, leveraging bacterial machinery for cost-effective scalability. Production protocols include:

ParameterDetail
Expression SystemE. coli BL21 or similar strains optimized for soluble protein yield
TagPolyhistidine (His-tag) or other affinity tags added during cloning
PurificationImmobilized metal affinity chromatography (IMAC) under native conditions
StorageTris-based buffer with 50% glycerol at -20°C or -80°C

Critical notes:

  • Repeated freeze-thaw cycles degrade protein integrity.

  • Working aliquots stored at 4°C remain stable for ≤7 days .

Role in Chloroplast Physiology

cemA facilitates ion transport across the chloroplast envelope, maintaining pH homeostasis and supporting photosynthesis. Studies on homologous proteins in Barbarea verna and Arabidopsis suggest its involvement in regulating stromal CO₂ concentrations .

Use in ELISA and Immunoassays

The recombinant protein serves as an antigen for antibody validation. For example:

  • ELISA Sensitivity: Detected at concentrations as low as 0.1 µg/mL in optimized assays .

  • Cross-Reactivity: Demonstrated specificity with antibodies raised against conserved chloroplast membrane epitopes .

Genomic and Evolutionary Context

The cemA gene is part of the chloroplast genome, which in Eucalyptus species spans ~153–155 kbp and encodes 84–94 protein-coding genes . Comparative analyses of chloroplast genomes (Table 1) highlight cemA’s conservation across angiosperms:

Table 1: Chloroplast Genome Features Across Species

SpeciesGenome Size (bp)Protein-Coding GenescemA Presence
Eucalyptus globulus~153,00084Yes
Swertia mussotii153,43184Yes
Gentiana straminea148,99183Yes

Research Gaps and Future Directions

  • Structural Studies: No crystallographic data exists for cemA; resolving its 3D structure could clarify transport mechanisms.

  • Functional Knockouts: Gene-editing studies in Eucalyptus are needed to elucidate cemA’s role in stress responses .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
cemA
Target Protein Sequence
MVKKKAFLPLLYLTSIVFLPWWISLSFNKSLEFWITNWWNTRQSETFLTDIQEKSILEKF IELEELLLLDEMIKEYPETHLQTLRIGIHKETIQLIKMHNEDHIHMILHLSTNITSFIIL SGYSILGNEELAILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYVYKD FGFAHNDQIISGLVSTFPVILDTIFKYWIFRYLNRISPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How is the cemA gene structured and positioned within the chloroplast genome?

The cemA gene is typically located in the Large Single Copy (LSC) region of the chloroplast genome. In comparable chloroplast genomes such as that of Adinandra megaphylla, which provides a reference model, the chloroplast genome exhibits a quadripartite structure comprising a large single-copy (LSC) region of 85,688 bp, a small single-copy (SSC) region of 18,424 bp, and a pair of inverted repeats (IRa and IRb) of 26,093 bp each . Within this genomic arrangement, cemA is among the 86 protein-coding genes annotated in the chloroplast genome, reflecting its evolutionary conservation and metabolic importance.

What is known about the conservation of cemA across plant species?

Studies of chloroplast genomes reveal that cemA is highly conserved across diverse plant species, indicating its fundamental importance in plant metabolism. In analysis of chloroplast genomes such as that of Adinandra megaphylla, researchers have identified cemA as one of the conserved genes with specific functions maintained through evolutionary history . This conservation suggests structural and functional constraints on the protein, making comparative studies between Eucalyptus globulus and other species particularly valuable for understanding its role in plant metabolism.

What are the principal steps in producing recombinant cemA protein?

Production of recombinant cemA follows the standard workflow of recombinant protein biotechnology, with specific adaptations for membrane proteins:

  • Gene isolation from Eucalyptus globulus chloroplast DNA

  • Construction of an expression vector containing the cemA gene

  • Introduction of the vector into a suitable microbial host

  • Optimization of expression conditions

  • Protein isolation using appropriate membrane protein extraction methods

  • Purification while maintaining structural integrity

  • Functional validation through appropriate assays

This process requires careful optimization at each step, particularly given the challenges associated with membrane protein expression and purification .

Which expression systems are most suitable for recombinant cemA production?

Several expression systems can be employed for recombinant cemA production, each with specific advantages:

Expression SystemAdvantagesConsiderations for cemA
E. coliRapid growth, easy manipulationMay require specialized strains for membrane proteins
Yeast systemsEukaryotic protein processingBetter membrane protein folding machinery
Insect cellsAdvanced post-translational modificationsHigher cost but improved folding
Cell-free systemsEliminates toxicity issuesDirect incorporation into artificial membranes

The selection should be guided by the specific research requirements and downstream applications of the recombinant protein .

How do Design of Experiments (DoE) approaches improve recombinant cemA production?

Design of Experiments provides a systematic framework that significantly enhances recombinant protein production efficiency by:

  • Replacing inefficient one-factor-at-a-time approaches with factorial designs that capture complex interactions

  • Minimizing the number of experiments required to optimize multiple variables

  • Enabling quantitative prediction of optimal conditions through statistical modeling

  • Reducing costs and development time through efficient experimental design

  • Identifying critical parameters that most strongly influence cemA expression and purification

Various software packages facilitate DoE implementation, allowing researchers to efficiently design experiments, analyze results, and develop predictive models that optimize recombinant cemA production .

What specific challenges arise when expressing recombinant membrane proteins like cemA?

Recombinant production of chloroplast membrane proteins presents several distinct challenges:

  • Proper membrane insertion and folding in heterologous systems

  • Potential toxicity to host cells when overexpressed

  • Low solubility and tendency to form non-functional aggregates

  • Requirements for specific lipid environments to maintain native structure

  • Difficulties in extraction while preserving functional integrity

  • Complex purification requirements due to hydrophobic domains

Addressing these challenges requires specialized strategies including optimization of host systems, expression conditions, and purification protocols specifically designed for membrane proteins .

Which critical factors must be optimized to maximize recombinant cemA yield and quality?

Multiple interdependent factors influence the successful production of functional recombinant cemA:

Factor CategorySpecific ParametersOptimization Approach
Genetic designCodon optimization, fusion tags, promoter strengthBioinformatic analysis and comparative testing
Host selectionStrain characteristics, membrane compositionScreening multiple expression hosts
Culture conditionsTemperature, pH, media composition, induction timingFactorial experimental design
Extraction methodDetergent selection, solubilization conditionsSystematic screening of detergents and conditions
Purification protocolChromatography methods, buffer compositionMethod development with retention of activity testing

DoE approaches provide an efficient framework for systematically evaluating these factors and their interactions, enabling researchers to develop optimized production protocols .

How can researchers validate that recombinant cemA maintains its native structure and function?

Comprehensive validation of recombinant cemA requires multiple analytical approaches:

  • Structural analysis using circular dichroism to assess secondary structure elements

  • Membrane integration assays using artificial membrane systems

  • Functional assays measuring carbon metabolism-related activities

  • Comparison with native cemA extracted from Eucalyptus chloroplasts

  • Protein-protein interaction studies with known binding partners

  • In vitro reconstitution of relevant metabolic pathways

Each validation method provides complementary information about protein integrity and functionality, and researchers typically need to employ multiple approaches to ensure the recombinant protein faithfully represents the native cemA .

How should researchers design experiments to investigate cemA function in carbon metabolism?

To effectively investigate cemA's role in carbon metabolism, researchers should implement a multi-faceted experimental design:

  • Gene expression manipulation studies (knockdown/knockout/overexpression)

  • Protein-protein interaction mapping using techniques such as co-immunoprecipitation or yeast two-hybrid systems

  • Metabolic flux analysis to track carbon movement in systems with modified cemA

  • Structural studies to elucidate mechanism of action

  • Comparative studies across Eucalyptus varieties with different photosynthetic efficiencies

  • Environmental response studies under varying CO2 conditions

These approaches should be designed with appropriate controls and statistical power to generate robust, reproducible results that clarify cemA's specific role in carbon metabolism pathways .

What bioinformatic approaches are valuable for analyzing cemA sequence and structural features?

Comprehensive bioinformatic analysis of cemA involves multiple computational tools and approaches:

  • Multiple sequence alignment tools to identify conserved regions across species

  • Transmembrane topology prediction to map membrane-spanning domains

  • Protein structure prediction using tools like AlphaFold2 for structural modeling

  • Phylogenetic analysis to understand evolutionary relationships

  • Functional domain prediction to identify critical regions

  • Molecular dynamics simulations to study protein behavior in membrane environments

These computational approaches provide valuable insights that can guide experimental design and interpretation of results when studying cemA structure-function relationships .

What methods are appropriate for studying recombinant cemA interaction with other chloroplast proteins?

Several complementary methods can be employed to study protein interactions:

MethodApplication to cemA ResearchTechnical Considerations
Co-immunoprecipitationIdentification of stable interaction partnersRequires specific antibodies and gentle solubilization
Yeast two-hybridScreening for potential interactorsMay need membrane-specific Y2H systems
Bimolecular fluorescence complementationVisualizing interactions in vivoRequires plant transformation systems
Surface plasmon resonanceQuantifying binding kineticsNeeds careful membrane protein immobilization
Crosslinking mass spectrometryIdentifying proximity relationshipsSpecialized analysis for membrane proteins

Selection of appropriate methods should consider the membrane-associated nature of cemA and the biochemical characteristics of potential interaction partners .

How can researchers address solubility and stability challenges with recombinant cemA?

When encountering solubility and stability issues with recombinant cemA, several strategic approaches should be considered:

  • Screening of multiple detergents and solubilization conditions using a systematic approach

  • Testing of fusion partners specifically designed to enhance membrane protein solubility

  • Optimization of buffer compositions to include stabilizing agents such as glycerol or specific lipids

  • Evaluation of alternative expression systems with enhanced capacity for membrane protein production

  • Implementation of co-expression with chaperones that facilitate proper folding

Systematic documentation of conditions tested and results obtained is essential for building knowledge about cemA behavior in recombinant systems .

What analytical techniques are most informative for characterizing recombinant cemA structure?

Structural characterization of recombinant cemA requires specialized techniques suitable for membrane proteins:

  • Circular dichroism spectroscopy to assess secondary structure content

  • Limited proteolysis combined with mass spectrometry to probe protein topology

  • Cryo-electron microscopy for structural determination in membrane environments

  • Nuclear magnetic resonance (NMR) spectroscopy for dynamic structural information

  • Hydrogen-deuterium exchange mass spectrometry to examine protein dynamics and accessibility

These techniques provide complementary structural information that, when combined, offers comprehensive insights into cemA structure in membrane environments .

How can contradictory experimental results in cemA research be reconciled?

When faced with contradictory results in cemA research, a systematic approach to reconciliation includes:

  • Careful examination of experimental conditions that may explain different outcomes

  • Consideration of the specific Eucalyptus globulus variant or subspecies used in each study

  • Assessment of recombinant protein design differences (fusion tags, truncations, etc.)

  • Evaluation of membrane composition effects on protein function

  • Replication studies with standardized protocols to confirm observations

  • Meta-analysis of available data to identify patterns and sources of variation

How does cemA from Eucalyptus globulus compare to homologous proteins in other plant species?

Comparative analysis of cemA across species reveals important insights:

FeatureObservation in Chloroplast Genome StudiesSignificance
Gene locationConserved in LSC regionEvolutionary stability of chloroplast genome organization
Sequence conservationHigh conservation of functional domainsCore functionality maintained across species
Copy numberSingle copy in chloroplast genomeConsistent with essential metabolic functions
Genomic contextSimilar neighboring genesConservation of gene clusters related to function

This comparative approach identifies both conserved elements that are likely critical for function and variable regions that may confer species-specific properties to the cemA protein .

What emerging technologies might advance research on recombinant cemA?

Several cutting-edge technologies show promise for advancing cemA research:

  • CRISPR-Cas9 genome editing for precise modification of cemA in native plant systems

  • Nanopore-based techniques for studying single-molecule properties of membrane proteins

  • Advanced cryo-EM methods for structural determination in near-native conditions

  • Artificial intelligence approaches for predicting protein interactions and functional networks

  • Microfluidic systems for high-throughput screening of expression and purification conditions

These technologies may overcome current limitations in studying membrane proteins like cemA, potentially revealing new aspects of its structure and function in carbon metabolism .

How might understanding cemA function contribute to broader research on photosynthesis efficiency in Eucalyptus species?

Research on cemA has significant implications for understanding photosynthetic efficiency:

  • Elucidation of carbon dioxide transport and utilization mechanisms

  • Identification of rate-limiting steps in carbon fixation pathways

  • Understanding adaptation mechanisms to different environmental conditions

  • Potential targets for enhancing photosynthetic efficiency through genetic engineering

  • Comparative analysis of high-efficiency vs. low-efficiency Eucalyptus varieties

This knowledge could inform both fundamental understanding of photosynthesis and applied research aimed at improving plant productivity and carbon sequestration capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.