Recombinant Eucalyptus globulus subsp. globulus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTVVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, this protein mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD subunit play in photosynthesis?

The cytochrome b6-f complex is a crucial enzyme found in the thylakoid membrane of chloroplasts in plants, cyanobacteria, and green algae. It occupies a central position in photosynthetic electron transport, linking Photosystem II to Photosystem I in linear electron flow and facilitating cyclic electron flow around PSI .

The complex catalyzes the transfer of electrons from plastoquinol to plastocyanin:

  • plastoquinol + 2 oxidized plastocyanin + 2 H⁺[side 1] → plastoquinone + 2 reduced plastocyanin + 4 H⁺[side 2]

The petD gene encodes cytochrome b6-f complex subunit 4, a 17 kDa protein component (also known as subunit IV) of the complex . This subunit, together with cytochrome b6, forms a structure analogous to cytochrome b in mitochondrial complex III. The petD subunit is essential for the assembly, stability, and proper function of the entire cytochrome b6-f complex, which not only facilitates electron transfer but also participates in proton translocation across the thylakoid membrane, contributing to ATP synthesis .

Why is research on recombinant petD from Eucalyptus globulus important?

Research on recombinant petD from Eucalyptus globulus is important for several reasons:

  • Fundamental understanding of photosynthesis: Studying the structure-function relationships of cytochrome b6-f components advances our knowledge of photosynthetic mechanisms .

  • Eucalyptus as an economically valuable species: Eucalyptus is an important plantation tree with high economic value globally, particularly in timber production, and understanding its biology can aid breeding programs .

  • Genetic improvement opportunities: Understanding the function of key genes like petD can inform genetic engineering strategies to enhance desirable traits in Eucalyptus .

  • Comparative studies: Insights from Eucalyptus petD can reveal evolutionary conservation and divergence patterns across plant species, as the cytochrome b6-f complex is crucial for all photosynthetic organisms .

  • Biotechnological applications: Recombinant proteins from economically important species can serve as tools for developing improved bioenergy crops and stress-resistant varieties .

What techniques are used to produce recombinant Eucalyptus globulus petD protein?

Production of recombinant Eucalyptus globulus petD protein typically involves:

  • Gene isolation and cloning:

    • PCR amplification of the petD gene from Eucalyptus globulus genomic DNA or cDNA

    • Insertion into an appropriate expression vector with necessary regulatory elements and tags

  • Expression system selection:

    • Bacterial systems (typically E. coli) for simple production

    • Yeast or insect cell systems for proteins requiring eukaryotic post-translational modifications

    • Plant-based expression systems for proteins requiring plant-specific modifications

  • Protein expression optimization:

    • Temperature, induction time, and inducer concentration optimization

    • Selection of appropriate host strain

    • Codon optimization for the expression host

  • Protein purification:

    • Affinity chromatography using tags (His-tag, GST, etc.)

    • Ion exchange chromatography

    • Size exclusion chromatography

  • Quality control:

    • SDS-PAGE and Western blotting to verify size and purity

    • Mass spectrometry for protein identification

    • Functional assays to confirm activity

When working with membrane proteins like petD, additional considerations include using appropriate detergents for solubilization and maintaining protein stability during purification .

How can researchers effectively regenerate and genetically transform Eucalyptus to study petD function?

Effective regeneration and genetic transformation of Eucalyptus to study petD function requires:

Regeneration System Optimization:

  • Explant selection: Different tissues show varying regeneration capacity. Commonly used explants include leaves, nodal segments, and cotyledons .

  • Media composition: Media supplemented with appropriate plant growth regulators (PGRs) is crucial:

    • Cytokinin BA (0.8–1.5 mg/L) and KT (0.3–1.0 mg/L) effectively promote adventitious bud induction

    • After bud induction, cytokinin concentration should be reduced to avoid inhibition of bud elongation

  • PGR selection: Common PGRs include:

    • Auxins: NAA, IAA, IBA, 2,4-D

    • Cytokinins: kinetin, BAP/BA, TDZ

Genetic Transformation Protocol:

  • Agrobacterium-mediated transformation:

    • Optimize Agrobacterium strain, concentration, and co-culture conditions

    • Include appropriate selection markers (often antibiotic resistance genes)

    • Consider preculture of explants before transformation to enhance success

  • Key factors affecting transformation efficiency:

    • Genotype (significant variation between Eucalyptus species and genotypes)

    • Antibiotic sensitivity for selection

    • Preculture conditions

    • Co-culture duration

  • Verification methods:

    • PCR to confirm transgene integration

    • RT-PCR to verify transgene expression

    • Western blotting to detect the recombinant protein

    • Functional assays to assess phenotypic effects

Researchers should be aware that Eucalyptus species have inherent challenges in genetic transformation, including "low conversion efficiency and instability," making it difficult to achieve consistent results for large-scale production .

How do mutations in the PEWY sequence of petD affect electron transport and state transitions in photosynthesis?

Mutations in the PEWY sequence of the petD gene have profound effects on electron transport and state transitions:

Effects on Electron Transport:

  • Complete block in electron transfer through the cytochrome b6-f complex when the PEWY sequence is mutated to PWYE .

  • Mechanistic insights from the pwye mutant in Chlamydomonas reinhardtii:

    • Loss of plastoquinol binding at the Qo site

    • Inhibition of the concerted electron transfer from plastoquinol to cytochrome f and heme bl

    • Impaired charge translocation across the membrane (observable as absence of phase b in electrochromic shift measurements)

  • While mutants may assemble wild-type levels of cytochrome b6-f complexes, these complexes are non-functional in electron transfer .

Impact on State Transitions:

  • State transitions require LHCII kinase activation, which is regulated by the redox state of the plastoquinone pool and cytochrome b6-f complex .

  • In the pwye mutant:

    • No fluorescence quenching is observed in state II conditions

    • Cells remain locked in state I

    • LHCII proteins remain poorly phosphorylated in both state conditions

  • These observations provide direct evidence that plastoquinol binding in the Qo pocket of the cytochrome b6-f complex is required for LHCII kinase activation and subsequent state transitions .

This demonstrates the critical role of the PEWY sequence in not only electron transport but also in the regulation of light energy distribution between photosystems, highlighting the dual function of the cytochrome b6-f complex in energy transfer and signaling .

What approaches can be used to study the interaction of petD with other subunits of the cytochrome b6-f complex?

Studying interactions between petD and other subunits of the cytochrome b6-f complex requires multidisciplinary approaches:

Structural Biology Techniques:

  • X-ray crystallography: Reveals atomic-level structure of the entire complex, as demonstrated in studies of cytochrome b6-f complexes from Chlamydomonas reinhardtii, Mastigocladus laminosus, and Nostoc sp.

  • Cryo-electron microscopy (cryo-EM): Provides high-resolution structural information without crystallization requirements

  • NMR spectroscopy: Useful for studying dynamic interactions and conformational changes

Biochemical and Biophysical Methods:

  • Co-immunoprecipitation: Identifies in vivo protein-protein interactions

  • Cross-linking coupled with mass spectrometry: Maps interaction interfaces between subunits

  • Blue native PAGE: Analyzes intact protein complexes and subcomplexes

  • Förster resonance energy transfer (FRET): Measures distances between fluorescently labeled subunits

  • Surface plasmon resonance (SPR): Determines binding kinetics between purified subunits

Genetic Approaches:

  • Site-directed mutagenesis: Identifies critical residues for interactions, as demonstrated in the PEWY sequence studies

  • Suppressor mutation analysis: Reveals functional relationships between subunits

  • Knockout/knockdown studies: Examines the effect of subunit absence on complex assembly, as shown in studies of PetG, PetL, and PetN

Computational Methods:

  • Molecular dynamics simulations: Models dynamic interactions between subunits

  • Protein-protein docking: Predicts interaction interfaces

  • Evolutionary covariance analysis: Identifies co-evolving residues likely to be at interaction interfaces

These approaches have revealed that petD (subunit IV) interacts closely with cytochrome b6, forming a structure functionally analogous to cytochrome b in mitochondrial respiratory complexes . Studies of low-molecular-weight subunits like PetG, PetL, and PetN have shown their essential roles in assembly and stability of the complex, with deletion of PetG or PetN causing loss of complex stability .

How does the genetic architecture of Eucalyptus globulus affect petD expression and function across different environments?

The genetic architecture of Eucalyptus globulus significantly influences petD expression and function across environments:

Genetic Factors Influencing Gene Expression:

  • Population genetic structure: Eucalyptus globulus exhibits significant subrace differentiation for various traits, suggesting local adaptation may influence gene expression patterns .

  • Inbreeding effects: Eucalyptus globulus has a mixed mating system with variable outcrossing rates (ranging from 65-89% in natural populations) . Inbreeding depression affects various traits and may influence expression of chloroplast genes:

    • Open-pollinated progenies show intermediate inbreeding depression compared to selfed and outcrossed populations

    • Self-fertilization results in reduced fitness and growth

  • Non-additive genetic effects: Studies have shown significant non-additive genetic effects for growth traits in Eucalyptus globulus , which may extend to photosynthetic efficiency traits related to petD function.

Environmental Interactions:

  • Genotype × environment interactions: Different genotypes may exhibit varying petD expression patterns across environments, affecting photosynthetic efficiency.

  • Adaptation to edaphoclimatic conditions: Eucalyptus globulus populations show adaptation to local conditions, potentially affecting optimal functioning of photosynthetic machinery .

  • Stress responses: Environmental stresses may alter petD expression and function, with genetic variation determining response magnitude.

Breeding Implications:

  • Selection potential: Variation in chloroplast gene function contributes to differences in growth rates and stress tolerance, providing targets for breeding programs .

  • Heterosis exploitation: Hybrid breeding programs in Eucalyptus take advantage of complementarity between species, potentially optimizing photosynthetic apparatus function .

  • Genomic selection approaches: Modern breeding programs incorporate genomic data to select superior genotypes, including those with optimal photosynthetic efficiency .

Research on transgenic eucalyptus (event H421) has shown that genetic modifications can be stable across different edaphoclimatic regions , suggesting that engineered modifications to petD or related genes could maintain their function across environments.

What quality control measures should be implemented when working with recombinant petD protein?

Comprehensive quality control for recombinant petD protein should include:

Purity Assessment:

  • SDS-PAGE analysis: To verify size and initial purity

    • Expected molecular weight: ~17 kDa for petD subunit

    • Consider using gradient gels (10-20%) for better resolution of smaller proteins

  • Western blotting: To confirm identity using specific antibodies

    • Use both tag-specific and protein-specific antibodies when available

  • Size exclusion chromatography: To assess aggregation state and homogeneity

    • Monitor absorbance at 280 nm (protein) and specific wavelengths for heme groups

  • Mass spectrometry:

    • MALDI-TOF or ESI-MS to confirm exact molecular weight

    • Peptide mass fingerprinting for sequence verification

    • Coverage should exceed 80% of the expected sequence

Functional Verification:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to verify characteristic absorption spectra

    • Circular dichroism to assess secondary structure integrity

  • Binding assays:

    • Plastoquinol binding assays (critical for Qo site function)

    • Interaction studies with other complex components

  • Electron transfer activity:

    • In vitro reconstitution assays with other components of the cytochrome b6-f complex

    • Measurement of electron transfer rates using artificial electron donors/acceptors

Stability Assessment:

  • Thermal stability: Differential scanning calorimetry or thermofluor assays

  • Storage stability: Activity retention over time at different temperatures

  • Buffer optimization: Testing different pH, salt concentrations, and additives

Contaminant Analysis:

  • Endotoxin testing: Essential for proteins intended for in vivo studies

  • Host cell protein assessment: ELISA-based methods to quantify host cell contaminants

  • DNA contamination: qPCR-based methods to quantify residual DNA

Documentation Standards:

Quality ParameterAcceptance CriteriaMethod
Purity>95%SDS-PAGE, SEC-HPLC
IdentityConfirmed sequenceMS/MS analysis
Activity>80% of reference standardSpecific functional assay
Aggregation<5%SEC-HPLC
Endotoxin<0.1 EU/μg proteinLAL test
Host cell protein<100 ppmHCP ELISA
Residual DNA<10 ng/mg proteinqPCR

How can researchers address data inconsistencies in experimental studies involving petD?

Addressing data inconsistencies in petD research requires systematic approaches:

Prevention Strategies:

  • Standardized protocols: Develop detailed SOPs for all experimental procedures:

    • Protein expression and purification

    • Activity assays

    • Data collection parameters

  • Automated data capture: Reduce manual data entry errors by implementing:

    • Electronic lab notebooks

    • Direct data transfer from instruments

    • Barcode or RFID sample tracking

  • Parameter verification: Implement double-checking systems for critical parameters:

    • Protein concentration

    • Reaction conditions

    • Instrument settings

Detection Methods:

  • Statistical outlier analysis: Apply methods to identify anomalous data points:

    • Z-score analysis

    • Dixon's Q test

    • Grubbs' test

  • Data visualization: Plot data in multiple ways to identify patterns and inconsistencies:

    • Scatter plots

    • Box plots

    • Heat maps

  • Cross-validation: Compare results from different methods measuring the same parameter

Resolution Approaches:

  • Root cause analysis: Systematically investigate sources of inconsistency:

    • Experimental conditions (temperature, pH, buffer composition)

    • Sample preparation variations

    • Instrument calibration issues

    • Reagent lot variations

  • Replication strategy: Design experiments with appropriate replication:

    • Technical replicates (same sample, multiple measurements)

    • Biological replicates (multiple independent samples)

    • Independent experimental repetitions

  • Data integration: Combine evidence from multiple approaches:

    • In vitro and in vivo studies

    • Different analytical techniques

    • Computational predictions

Handling Persistent Inconsistencies:

  • Transparent reporting: Document all inconsistencies and attempted resolutions

  • Meta-analysis approaches: Use statistical methods to integrate contradictory results

  • Collaborative verification: Engage other laboratories to independently replicate findings

Research on reproducibility in PET imaging has revealed that human errors in data entry can contribute significantly to data inconsistencies, with up to 41.8% of studies showing discrepancies between patient records and data entries . Similar issues may affect molecular biology research, emphasizing the need for robust data management systems.

What are common challenges in the expression and purification of recombinant petD protein and how can they be overcome?

Recombinant petD protein expression and purification presents several challenges due to its membrane protein nature:

Challenge 1: Poor Expression Levels

  • Cause: Membrane proteins often cause toxicity to host cells or form inclusion bodies

  • Solutions:

    • Use specialized expression hosts (C41(DE3), C43(DE3) for E. coli)

    • Lower expression temperature (16-20°C)

    • Reduce inducer concentration

    • Use weaker promoters or auto-induction media

    • Express fusion proteins with solubility-enhancing tags (MBP, SUMO)

Challenge 2: Protein Insolubility

  • Cause: Hydrophobic regions tend to aggregate during expression

  • Solutions:

    • Screen multiple detergents for solubilization (DDM, LDAO, Triton X-100)

    • Add lipids during extraction to stabilize native conformation

    • Consider cell-free expression systems with lipid nanodiscs

    • Use solubilization buffers with glycerol (10-20%) and salt (300-500 mM)

Challenge 3: Protein Instability

  • Cause: Membrane proteins often denature when removed from membrane environment

  • Solutions:

    • Optimize buffer conditions (pH, ionic strength)

    • Add stabilizing agents (glycerol, specific lipids)

    • Use amphipols or nanodiscs for long-term stability

    • Maintain detergent above critical micelle concentration

    • Perform all steps at 4°C with protease inhibitors

Challenge 4: Low Purity

  • Cause: Non-specific binding of host proteins to detergent micelles

  • Solutions:

    • Implement multi-step purification strategy

    • Use orthogonal chromatography techniques

    • Optimize washing conditions for affinity chromatography

    • Consider on-column detergent exchange

    • Include ionic exchange chromatography step

Challenge 5: Loss of Cofactors

  • Cause: Heme groups or other cofactors may dissociate during purification

  • Solutions:

    • Supplement buffers with cofactors

    • Avoid harsh solubilization conditions

    • Monitor spectroscopically for cofactor retention

    • Reconstitute cofactors if necessary

Optimization Table for petD Purification:

ProblemIndicatorSolutionValidation Method
Low expressionWeak band on SDS-PAGETry pET28a vector with T7 promoter; lower to 18°CWestern blot
InsolubilityProtein in pellet after lysisTest DDM (1%), LDAO (0.5%), Fos-choline-12 (0.1%)Solubility screening by SDS-PAGE
InstabilityActivity loss over timeAdd 10% glycerol, 150 mM NaCl, pH 7.5Activity assay after storage
ImpuritiesMultiple bands in elutionAdditional ion exchange step (Q-Sepharose)SDS-PAGE purity >95%
Cofactor lossAltered spectral propertiesAdd hemin (10 μM) during purificationUV-Vis spectroscopy

How can researchers troubleshoot failed genetic transformation attempts in Eucalyptus?

Troubleshooting genetic transformation in Eucalyptus requires systematic analysis of each step in the process:

Explant-Related Issues:

  • Poor explant viability:

    • Ensure proper sterilization without tissue damage

    • Use younger tissues (actively growing)

    • Optimize preculture media composition

    • Evaluate different source tissues (leaves, cotyledons, etc.)

  • Recalcitrant genotype:

    • Try different Eucalyptus genotypes/clones

    • Hybrid genotypes may show different transformation efficiencies

    • Consider genotype-specific optimization of protocols

Agrobacterium-Related Issues:

  • Inefficient infection:

    • Optimize bacterial density (OD600 typically 0.4-0.8)

    • Add acetosyringone (50-200 μM) to induce virulence genes

    • Adjust co-cultivation period (typically 2-4 days)

    • Try different Agrobacterium strains (EHA105, GV3101, AGL1)

  • Bacterial overgrowth:

    • Optimize washing steps post-infection

    • Include appropriate antibiotics in selection media

    • Consider adding cefotaxime or timentin to control Agrobacterium

Selection and Regeneration Issues:

  • High mortality during selection:

    • Determine minimum inhibitory concentration for each antibiotic

    • Use a gradual increase in selection pressure

    • Consider alternative selection markers (herbicide resistance)

    • Optimize growth regulator balance for stress tolerance

  • Escapes (non-transformed regenerants):

    • Increase selection pressure

    • Extend selection period

    • Use multiple selection markers

    • Implement early PCR screening

  • Poor regeneration efficiency:

    • Optimize cytokinin/auxin ratios

    • Try different media formulations

    • Adjust light conditions and temperature

    • Consider adding antioxidants to reduce oxidative stress

Transgene-Related Issues:

  • Silencing or low expression:

    • Use promoters known to work in Eucalyptus

    • Avoid sequences with high homology to endogenous genes

    • Consider codon optimization for Eucalyptus

    • Check for potential regulatory elements in the construct

Systematic Troubleshooting Approach:

  • Implement controls at each step:

    • Positive control for explant viability

    • GFP or GUS reporter genes to visualize transformation

    • Known transformable species as protocol control

  • Keep detailed records of all parameters:

    • Explant source and age

    • Media compositions and preparation dates

    • Environmental conditions

    • Transformation parameters

  • Develop a staged optimization strategy:

    • Test critical variables individually

    • Use statistical design of experiments (DOE) for multivariate optimization

    • Implement improvements incrementally

Research has shown that "stable and efficient Eucalyptus regeneration system and genetic transformation system are of great significance," but challenges such as "strong specificity of the regeneration system and a low genetic conversion rate seriously limit the rapid development of Eucalyptus genetics and breeding programs" .

What emerging technologies could advance our understanding of petD function in Eucalyptus globulus?

Several emerging technologies hold promise for advancing petD research in Eucalyptus:

CRISPR/Cas-Based Technologies:

  • Precise genome editing: Create specific mutations in the PEWY sequence to study structure-function relationships

  • Base editing: Introduce point mutations without double-strand breaks

  • Prime editing: Enable precise edits with minimal off-target effects

  • CRISPRi/CRISPRa: Modulate petD expression without permanent genomic changes

  • CRISPR-mediated chloroplast genome editing: Direct modification of the chloroplast petD gene

Advanced Imaging Techniques:

  • Super-resolution microscopy: Visualize subcellular localization and dynamic assembly of cytochrome b6-f complexes

  • Single-molecule FRET: Observe conformational changes during electron transport

  • Label-free imaging: Monitor cytochrome b6-f activity in living plants

  • Correlative light and electron microscopy (CLEM): Connect structural and functional data

Omics Integration:

  • Multi-omics approaches: Integrate transcriptomics, proteomics, and metabolomics data

  • Spatial transcriptomics: Map gene expression patterns in different leaf tissues

  • Phosphoproteomics: Study regulatory mechanisms through post-translational modifications

  • Systems biology modeling: Predict impacts of petD variations on photosynthetic efficiency

High-Throughput Phenotyping:

  • Automated photosynthesis measurement platforms: Assess phenotypic effects of petD modifications

  • Hyperspectral imaging: Non-invasively monitor photosynthetic parameters

  • Chlorophyll fluorescence imaging: Detect subtle changes in photosystem efficiency

  • Field-deployable sensors: Monitor plants under natural conditions

Computational Approaches:

  • AlphaFold/RoseTTAFold: Predict impacts of mutations on protein structure

  • Molecular dynamics simulations: Model electron transfer processes

  • Quantum mechanics/molecular mechanics (QM/MM): Study detailed electronic properties

  • Machine learning: Identify patterns in complex datasets linking genotype to phenotype

These technologies could help address key questions such as:

  • How do specific petD variants affect photosynthetic efficiency across different environments?

  • What is the atomic-level mechanism of electron transfer through the cytochrome b6-f complex?

  • How does petD contribute to the adaptation of Eucalyptus to different environmental conditions?

  • Can targeted modifications of petD improve growth rates or stress tolerance in Eucalyptus?

How might genomic selection approaches incorporate petD variation to improve Eucalyptus breeding programs?

Incorporating petD variation into genomic selection strategies could enhance Eucalyptus breeding programs:

Current Genomic Selection Status in Eucalyptus:

  • Genomic selection approaches have shown promising results in Eucalyptus breeding, with genomic predictive abilities (RPAs) ≥0.80 achieved under optimal conditions .

  • Studies demonstrate that "genomic data effectively enable accurate ranking of eucalypt hybrid seedlings for their yet-to-be observed volume growth at harvest age" .

  • A two-stage genomic selection approach has been recommended, involving family selection by average genomic breeding value, followed by within-top-families individual genomic selection .

Integration of petD Variation:

  • Marker development:

    • Develop SNP markers associated with petD sequence variations

    • Include markers for genes interacting with cytochrome b6-f complex

    • Target regulatory regions affecting petD expression

  • Phenotyping strategies:

    • Incorporate photosynthetic efficiency measurements

    • Assess electron transport rates under different conditions

    • Measure chlorophyll fluorescence parameters linked to cytochrome b6-f function

  • Selection models:

    • Implement GBLUP (genomic best linear unbiased prediction) models incorporating petD markers

    • Develop Bayesian models assigning higher weights to photosynthesis-related genes

    • Explore HBLUP (hybrid BLUP) approaches combining genomic and pedigree information

Potential Applications:

  • Improved growth prediction:

    • Enhanced prediction of mean annual increment (MAI) by including photosynthetic efficiency

    • Better identification of genotypes with optimal source-sink relationships

    • Prediction models with h² ≥ 0.59 for growth traits have been achieved in "urograndis" eucalypts

  • Stress tolerance breeding:

    • Select variants with robust electron transport under stress conditions

    • Identify genotypes maintaining photosynthetic efficiency during drought or heat stress

    • Develop climate-resilient varieties

  • Hybrid breeding optimization:

    • Exploit complementarity between species in photosynthetic apparatus

    • Enhance heterosis effects on photosynthetic efficiency

    • The "urograndis" hybrid (E. urophylla × E. grandis) represents a successful example of hybrid vigor exploitation

  • Recombination optimization:

    • Account for variation in recombination rates across the Eucalyptus genome

    • Target regions with appropriate recombination rates for trait introgression

    • Eucalyptus globulus shows significant heterogeneity in recombination rates between individuals and chromosomes

Implementation Challenges:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.