Recombinant Eucalyptus globulus subsp. globulus Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

PetB is a core subunit of the cytochrome b6f complex, which catalyzes plastoquinol oxidation and plastocyanin reduction. This reaction generates a proton gradient for ATP synthesis and regulates redox signaling between photosystems .

ProcessRole of PetB
Electron TransportTransfers electrons between plastoquinol and plastocyanin via heme groups
Proton TranslocationDrives H⁺ pumping across thylakoid membranes
Redox RegulationModulates electron flow between PSII and PSI to optimize photosynthetic efficiency

Recombinant PetB Applications:

  • Biochemical Studies: Examining subunit interactions and electron transfer mechanisms .

  • Structural Analysis: Resolving heme-binding sites and membrane topology using crystallography or NMR .

  • Antibody Development: Serves as immunogen for anti-PetB antibodies used in Western blotting and localization studies .

Production and Purification

The recombinant PetB is typically expressed in E. coli using a T7 promoter system. Key steps include:

  1. Cloning: Insertion of the petB gene into a prokaryotic expression vector (e.g., pET series).

  2. Induction: IPTG-mediated expression under optimized growth conditions.

  3. Purification: Ni-NTA affinity chromatography to isolate His-tagged protein, followed by gel filtration for further polishing .

StepConditions
Expression HostE. coli BL21(DE3) or equivalent strains
Induction Temperature16–37°C (optimized for solubility)
Purification Yield~1–5 mg/L culture (varies with expression efficiency)

Challenges:

  • Proper Folding: Heme incorporation and membrane integration may require in vitro refolding .

  • Stability: Susceptibility to oxidation and proteolytic degradation necessitates stabilization agents .

Genetic and Biochemical Insights

Plastid vs. Recombinant PetB:

FeatureNative PetBRecombinant PetB
Expression SitePlastid thylakoid membranesE. coli cytoplasm
Post-Translational ModsLipid anchoring, heme insertionNone (unless engineered)
FunctionalityFull activity in native complexPartial activity (requires co-factors)

Key Findings:

  • Essential Role in Complex Assembly: PetB deletion in plants leads to destabilization of the cytochrome b6f complex, highlighting its structural importance .

  • Species-Specific Variations: E. globulus PetB shares 80–90% identity with other plant orthologs (e.g., Arabidopsis thaliana) but retains unique residues for functional adaptation .

Research Applications and Recent Advances

Applications of Recombinant PetB:

  1. Structural Biology: Elucidating heme-binding sites and subunit interactions in the cytochrome b6f complex .

  2. Biotechnology: Engineering PetB variants for enhanced electron transfer efficiency in biohybrid systems.

  3. Diagnostic Tools: Serving as a reference antigen in serological assays for plant stress studies .

Recent Studies:

  • Antibody Development: Polyclonal anti-PetB antibodies (e.g., AS18 4169) enable precise detection of cytochrome b6f complex dynamics in Western blotting and BN-PAGE .

  • Functional Studies: Mutagenesis of conserved residues (e.g., heme ligands) to dissect electron transfer pathways .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its role in photosynthetic organisms?

Cytochrome b6 is an integral component of the cytochrome b6f complex, which plays a crucial role in the photosynthetic and respiratory electron transfer chains of oxygenic photosynthetic organisms. This complex serves as an essential intermediate in the electron transport pathway, facilitating electron movement between photosystems in thylakoid membranes. In Eucalyptus globulus, as in other photosynthetic eukaryotes, cytochrome b6 is encoded by the petB gene located in the chloroplast genome. The protein functions within a membrane-bound complex that contributes to establishing the proton gradient necessary for ATP synthesis .

The cytochrome b6f complex typically consists of four core subunits: cytochrome b6, cytochrome f, subunit IV, and the Rieske protein (PetC). Together, these components enable efficient energy conversion during photosynthesis by mediating electron transfer and contributing to proton translocation across the thylakoid membrane .

What are the optimal storage and handling conditions for recombinant Cytochrome b6 protein?

For optimal stability and activity preservation of recombinant Eucalyptus globulus Cytochrome b6 protein:

  • Short-term storage: Store working aliquots at 4°C for up to one week to maintain protein functionality while allowing convenient access for ongoing experiments.

  • Standard storage: Maintain at -20°C in a Tris-based buffer containing 50% glycerol (optimized specifically for this protein).

  • Long-term preservation: For extended storage periods, conserve at -80°C to minimize degradation and preserve activity.

  • Avoid freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can compromise protein integrity and function. Instead, prepare small working aliquots during initial thawing .

How does the structure of Cytochrome b6 relate to its function in electron transfer?

The structure of Cytochrome b6 is highly specialized for its electron transfer function, featuring:

  • Transmembrane helices: The protein contains multiple transmembrane segments (evident in the sequence "ITLTCFLVQVATGFAMTFYYRP") that anchor it within the thylakoid membrane. These segments create a hydrophobic environment necessary for proper protein folding and function .

  • Heme-binding regions: Cytochrome b6 binds heme groups that facilitate electron transfer. The conserved regions in the sequence enable coordination with these prosthetic groups, which are essential for the redox reactions during electron transport.

  • Interaction domains: Specific regions of the protein sequence facilitate interactions with other components of the cytochrome b6f complex, particularly the Rieske protein (PetC) and cytochrome f, ensuring efficient electron tunneling between components .

  • Quinol-binding sites: The protein contains binding sites for plastoquinol/plastoquinone, allowing it to accept and donate electrons during the Q-cycle, a process that contributes to proton translocation across the membrane.

What expression systems are typically used for producing recombinant Cytochrome b6?

For efficient production of functional recombinant Cytochrome b6 from Eucalyptus globulus, researchers typically employ the following expression systems:

Each system requires optimization of codon usage, temperature, induction conditions, and extraction methods to obtain properly folded, functional protein with correctly inserted cofactors.

How do the properties of Eucalyptus globulus Cytochrome b6 compare to those of cyanobacterial homologs?

While Eucalyptus globulus Cytochrome b6 and cyanobacterial homologs share fundamental functional roles in electron transfer, they exhibit several important differences:

FeatureEucalyptus globulus Cytochrome b6Cyanobacterial Cytochrome b6 (e.g., Synechocystis)
Membrane localizationExclusively in thylakoid membranesPresent in both thylakoid and cytoplasmic membranes
Complex compositionFour core subunits with additional eukaryotic subunitsFour core subunits (PetB, PetD, PetC, PetA)
Rieske protein interactionSingle Rieske protein variantMultiple Rieske protein paralogs (e.g., PetC1, PetC2, PetC3) with differential localization
Functional regulationLight-regulated expression, post-translational modificationsEnvironmental response elements, potential dual function in respiration
Cyclic electron flow involvementPrimarily photosynthetic functionInvolved in both photosynthetic and respiratory electron transport

In cyanobacteria like Synechocystis, studies have revealed interesting compartmentalization patterns. The PetC1 and PetC2 Rieske proteins and other core subunits are exclusively localized to the thylakoid membranes, while PetC3 is uniquely found in the cytoplasmic membrane. This differential localization suggests distinct evolutionary adaptations in electron transport systems between cyanobacteria and higher plants like Eucalyptus .

What experimental approaches are most effective for studying the electron transfer function of recombinant Cytochrome b6?

Several sophisticated experimental approaches can be employed to investigate the electron transfer properties of recombinant Eucalyptus globulus Cytochrome b6:

  • Electrochemical techniques:

    • Cyclic voltammetry to determine redox potentials

    • Protein film voltammetry for direct measurement of electron transfer kinetics

    • Spectroelectrochemistry to correlate spectral changes with redox states

  • Spectroscopic methods:

    • UV-visible absorption spectroscopy to monitor heme redox state transitions

    • Electron paramagnetic resonance (EPR) to characterize paramagnetic centers

    • Resonance Raman spectroscopy to probe heme environment and protein interactions

    • Time-resolved fluorescence to measure electron transfer rates between components

  • Reconstitution experiments:

    • Incorporation into liposomes or nanodiscs to study membrane-dependent functions

    • Co-reconstitution with other components of the b6f complex to assess interactions

    • Artificial electron donor/acceptor systems to isolate specific electron transfer steps

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues involved in cofactor binding

    • Analysis of electron transfer rates in mutant variants

    • Correlation of structural changes with functional alterations

  • Advanced microscopy:

    • Single-molecule FRET to track conformational changes during electron transfer

    • Cryo-electron microscopy for structural insights into the assembled complex

    • Atomic force microscopy to examine membrane integration and complex assembly

These approaches, used in combination, provide complementary insights into the electron transfer mechanisms of cytochrome b6 within the photosynthetic apparatus.

How can recombinant Cytochrome b6 be utilized in artificial photosynthesis research?

Recombinant Eucalyptus globulus Cytochrome b6 offers several innovative applications in artificial photosynthesis research:

  • Bio-hybrid photovoltaic systems:

    • Integration with semiconductor materials to create bio-hybrid interfaces

    • Development of biomimetic electron transport chains on electrode surfaces

    • Engineering of photoresponsive bioelectronic devices

  • Reconstituted membrane systems:

    • Creation of minimal functional units for electron transport studies

    • Design of optimized electron transport chains with enhanced efficiency

    • Development of biomimetic membranes for energy conversion applications

  • Protein engineering platforms:

    • Template for designing enhanced electron carriers with improved stability

    • Creation of chimeric proteins with optimized electron transfer properties

    • Development of fusion proteins linking light-harvesting and electron transfer functions

  • Biosensor applications:

    • Design of electron-transfer based biosensing elements

    • Creation of photosynthesis-inspired redox sensors for environmental monitoring

    • Development of screening platforms for photosynthesis inhibitors or enhancers

  • Educational models:

    • Development of tangible models for demonstrating electron transport principles

    • Creation of interactive teaching tools for photosynthesis research

The implementation of these applications requires careful consideration of protein stability, cofactor incorporation, and interface design to maintain native-like electron transfer properties while enhancing device performance.

What genomic approaches can advance our understanding of Cytochrome b6 variation across Eucalyptus species?

Modern genomic approaches offer powerful tools for exploring cytochrome b6 variation across Eucalyptus species:

  • Comparative genomics:

    • Sequence analysis across the Eucalyptus genus to identify conserved and variable regions

    • Correlation of sequence variations with ecological adaptations and photosynthetic efficiency

    • Phylogenetic analysis to trace the evolutionary history of the petB gene

  • Genomic selection approaches:

    • Development of marker-assisted selection for photosynthetic efficiency traits

    • Implementation of breeding programs focused on optimizing electron transport chain components

    • Utilization of genomic prediction models to identify superior genotypes for bioenergy applications

  • Transcriptomics integration:

    • Analysis of petB expression patterns across tissues, developmental stages, and stress conditions

    • Correlation of expression levels with photosynthetic performance metrics

    • Identification of regulatory elements controlling cytochrome b6 expression

  • Functional genomics:

    • CRISPR-Cas9 editing of petB to create modified variants for functional studies

    • Development of heterologous expression systems for rapid assessment of sequence variants

    • High-throughput phenotyping of photosynthetic parameters in variant populations

Recent genomic selection studies in Eucalyptus have demonstrated high predictive abilities (≥0.80) when genetic relatedness between generations is considered, suggesting that similar approaches could be valuable for studying cytochrome b6 variations and their impact on photosynthetic efficiency .

How do post-translational modifications affect Cytochrome b6 function in Eucalyptus?

Post-translational modifications (PTMs) play critical roles in regulating Cytochrome b6 function in Eucalyptus and other plants:

  • Phosphorylation:

    • Modulates protein-protein interactions within the b6f complex

    • Regulates electron transfer rates in response to environmental conditions

    • May serve as a mechanism for state transitions between photosystems

  • Redox modifications:

    • Thiol modifications (e.g., glutathionylation) in response to oxidative stress

    • Disulfide bond formation affecting protein stability and activity

    • Redox-dependent structural changes influencing electron transfer efficiency

  • Cofactor modifications:

    • Alterations in heme attachment or chemistry affecting redox potential

    • Modifications of quinone binding sites influencing substrate affinity

    • Changes in metal coordination affecting electron transfer rates

  • Proteolytic processing:

    • N-terminal processing during chloroplast import and maturation

    • Regulatory proteolysis in response to damage or turnover requirements

    • Stress-induced modifications affecting protein half-life

  • Membrane environment effects:

    • Lipid interactions influencing protein conformation and stability

    • Membrane fluidity changes affecting complex assembly and function

    • Lateral mobility alterations impacting electron transport chain super-complex formation

Research on these modifications requires sophisticated analytical approaches including mass spectrometry, site-specific antibodies, and in vivo imaging techniques to correlate PTMs with functional consequences for photosynthetic electron transport.

What are the most promising future research applications for Recombinant Eucalyptus globulus Cytochrome b6?

Several cutting-edge research directions show particular promise for advancing our understanding and application of Recombinant Eucalyptus globulus Cytochrome b6:

  • Climate adaptation studies: Investigating how cytochrome b6 variants contribute to photosynthetic efficiency under changing environmental conditions, particularly relevant for Eucalyptus species adapted to diverse climates.

  • Bioenergy applications: Exploring the potential for engineered cytochrome b6 variants to enhance biomass production in fast-growing Eucalyptus species used for bioenergy.

  • Synthetic biology platforms: Developing minimal artificial photosynthetic systems incorporating optimized cytochrome components for sustainable energy production.

  • Structural biology innovations: Applying emerging techniques like cryo-electron microscopy and X-ray free-electron laser crystallography to resolve dynamic aspects of electron transfer in the cytochrome b6f complex.

  • Systems biology integration: Combining multi-omics approaches to understand how cytochrome b6 functions within the broader context of photosynthetic regulation networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.