Recombinant Eucalyptus globulus subsp. globulus NAD (P)H-quinone oxidoreductase subunit 1, chloroplastic (ndhA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

ndhA is a subunit of the chloroplast NADH dehydrogenase-like (NDH) complex, which facilitates:

  • Photosystem I Cyclic Electron Transport: Shuttles electrons from NAD(P)H to plastoquinone, maintaining ATP/NADPH balance during photosynthesis .

  • Chlororespiration: Mediates electron transfer to plastoquinone under stress, protecting chloroplasts from oxidative damage .

  • Proton Gradient Formation: Couples redox reactions to proton translocation, conserving energy for ATP synthesis .

The enzyme’s activity is tightly linked to RNA metabolism; its transcripts are stabilized by pentatricopeptide repeat (PPR) proteins like SOT1 and assisted by splicing factors CAF1/2 .

RNA Stabilization and Splicing

  • SOT1-CAF Interaction: CAF1/2 proteins enhance SOT1’s binding to ndhA mRNA 5′-ends, inhibiting RNA degradation by the SMR domain .

  • Splicing Efficiency: SOT1 promotes ndhA intron splicing by facilitating CAF2 association, improving transcript stability .

Evolutionary Conservation

  • RNA Editing: Maize ndhA undergoes C-to-U RNA editing at four sites to restore conserved amino acids, a mechanism likely shared across plants .

Biochemical Activity

  • Substrate Specificity: Prefers short-chain quinones (e.g., plastoquinone) as electron acceptors .

  • Detoxification Role: Reduces quinones to hydroquinones, minimizing reactive oxygen species (ROS) generation .

Applications and Significance

  • Photosynthesis Research: Used to study NDH complex assembly and cyclic electron flow mechanisms .

  • Biotechnology: Recombinant production enables structural studies and enzyme engineering for stress-tolerant crops .

  • Ecotoxicology: Insights into quinone detoxification inform phytoremediation strategies .

Technical Considerations

  • Reconstitution: Optimal solubility requires reconstitution in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol .

  • Stability: Repeated freeze-thaw cycles degrade activity; single-use aliquots are recommended .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhA; NAD(PH-quinone oxidoreductase subunit 1, chloroplastic; NAD(PH dehydrogenase subunit 1; NDH subunit 1; NADH-plastoquinone oxidoreductase subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
ndhA
Target Protein Sequence
MIIDTTEVQDLNSFSRLESLKEVYGIIGMFLPILTLVLGITIGVLVIVWLEREISAGIQQ RIGPEYAGPLGILQALADGTKLIFKENLFPSRGDTRLFSIGPSIAVISILLSYSVIPFSY HLVLSDLNIGVFLWIAISSIAPIGLLMSGYGSNNKYSFLSGLRAAAQSISYEIPLTLLCV INISLSNSSSTVDIVEAQSKYGFWGWNLWRQPIGFFIFLISSLAECERLPFDLPEAEEEL VAGYQTEYSGIKFGLFYVASYLNLLVSSLFVTVLYLGGWNISIPYIFVPELFEINKVGRV FGTTIGIFITLAKTYFFLFISITTRWTLPRLRIDQLLNLGWKFLLPISLGNLLLTTSFQL LSL
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones in the photosynthetic chain, potentially including a chloroplast respiratory chain. The immediate electron acceptor for this enzyme in this species is believed to be plastoquinone. This process couples the redox reaction to proton translocation, conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 1 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of recombinant Eucalyptus globulus ndhA protein?

Recombinant Eucalyptus globulus subsp. globulus NAD(P)H-quinone oxidoreductase subunit 1 (ndhA) is a full-length protein (363 amino acids) with an N-terminal His-tag expressed in E. coli. The protein sequence contains multiple transmembrane domains characteristic of membrane-bound oxidoreductases and features conserved regions for nucleotide binding and electron transfer. The protein maintains the native amino acid sequence (1-363aa) of the chloroplastic ndhA protein (Q49KU3) with the addition of the His-tag to facilitate purification and detection in experimental applications .

How does the recombinant ndhA protein differ from native Eucalyptus globulus ndhA?

The recombinant ndhA protein preserves the primary structure of native ndhA but includes an N-terminal His-tag not present in the native form. While the amino acid sequence (1-363) matches that of the native protein, expression in a prokaryotic E. coli system means the recombinant protein lacks post-translational modifications that might be present in the plant-derived counterpart. Additionally, the recombinant protein is purified and provided as a lyophilized powder rather than in its native membrane-embedded state, which may affect conformational properties compared to the native protein found in Eucalyptus globulus chloroplasts .

What are the biochemical functions of NAD(P)H-quinone oxidoreductase in plant systems?

NAD(P)H-quinone oxidoreductase functions primarily in the chloroplast electron transport chain, catalyzing the reduction of quinones using NADH or NADPH as electron donors. This enzyme plays critical roles in:

  • Cyclic electron flow around photosystem I

  • Chlororespiration

  • Photosystem II-independent reduction of plastoquinone

  • Stress response mechanisms, particularly under high light or drought conditions

  • Maintenance of appropriate redox balance within the chloroplast

The ndhA subunit, specifically, contributes to the membrane domain of the NDH complex, facilitating proton translocation across the thylakoid membrane, which contributes to ATP synthesis.

What are the recommended approaches for reconstituting lyophilized recombinant ndhA protein for experimental use?

For optimal reconstitution of lyophilized recombinant ndhA protein:

  • Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect the powder at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Gently mix by inversion rather than vortexing to avoid protein denaturation

  • Aliquot the reconstituted protein into smaller volumes to prevent repeated freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage or at 4°C for up to one week if in active use

This methodology preserves protein integrity by minimizing exposure to freeze-thaw cycles that can lead to protein denaturation and activity loss .

How can researchers effectively measure the enzymatic activity of recombinant ndhA protein?

The enzymatic activity of recombinant ndhA protein can be measured through several complementary approaches:

  • Spectrophotometric assays:

    • Monitor the oxidation of NADH or NADPH at 340 nm in the presence of various quinone substrates

    • Calculate specific activity as μmol substrate converted per minute per mg protein

  • Polarographic methods:

    • Utilize oxygen electrodes to measure oxygen consumption during quinone reduction

    • Particularly useful for assessing activity under different substrate concentrations

  • Electron transfer assays:

    • Use artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCIP)

    • Monitor color change spectrophotometrically as indication of electron transfer

These assays should be performed in appropriate buffers (typically phosphate buffer, pH 6.5-7.5) with careful control of temperature (usually 25-30°C). For membrane proteins like ndhA, incorporation into liposomes or nanodiscs may be necessary to mimic the native membrane environment and achieve optimal activity measurements.

What are the most effective methods for determining the subcellular localization of recombinant ndhA in heterologous expression systems?

Determining subcellular localization of recombinant ndhA requires a multi-method approach:

  • Immunolocalization techniques:

    • Immunogold electron microscopy using anti-His antibodies

    • Immunofluorescence microscopy using confocal imaging

  • Biochemical fractionation:

    • Differential centrifugation to separate cellular compartments

    • Western blot analysis of fractions using anti-His or protein-specific antibodies

  • Fusion protein approaches:

    • Generate ndhA-GFP/YFP fusion constructs

    • Visualize localization in real-time using live-cell imaging

  • Proteomic analysis:

    • Mass spectrometry identification of ndhA in isolated organelle fractions

    • Quantitative comparison across different cellular compartments

For plant-based studies, transient expression in model systems like Arabidopsis or tobacco, followed by chloroplast isolation and subfractionation into stroma, thylakoid membrane, and lumen fractions, allows detailed analysis of targeting efficiency and membrane integration.

What storage conditions maximize the stability of recombinant ndhA protein for long-term research applications?

To maximize long-term stability of recombinant ndhA protein:

  • Short-term storage (1-7 days):

    • Store at 4°C in Tris/PBS-based buffer with 6% trehalose, pH 8.0

  • Medium-term storage (1-6 months):

    • Store at -20°C in buffer supplemented with 50% glycerol

    • Divide into single-use aliquots to prevent freeze-thaw cycles

  • Long-term storage (>6 months):

    • Store at -80°C in buffer with 50% glycerol and 6% trehalose

    • Seal containers to prevent dessication

    • Maintain in oxygen-free environment when possible

  • Stability enhancers:

    • Addition of reducing agents (1-5 mM DTT or 2-mercaptoethanol)

    • Protease inhibitor cocktails for sensitive applications

    • pH maintenance between 7.5-8.5

Regular quality control testing through activity assays is recommended for proteins stored longer than 6 months to ensure experimental reliability .

What protein purification techniques are most suitable for isolating recombinant His-tagged ndhA from bacterial expression systems?

Optimal purification of His-tagged ndhA from bacterial expression systems involves a multi-step approach:

  • Cell lysis optimization:

    • For membrane proteins like ndhA, use mild detergents (0.5-1% n-dodecyl-β-D-maltoside or CHAPS)

    • Include lysozyme (1 mg/mL) and DNase I (5 units/mL)

    • Sonication with cooling intervals to prevent protein denaturation

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Ni-NTA or cobalt-based resins with optimized imidazole gradients

    • Low imidazole (10-30 mM) in binding buffer to reduce non-specific binding

    • Elution with 250-300 mM imidazole gradient

  • Secondary purification:

    • Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Quality assessment:

    • SDS-PAGE with Coomassie or silver staining (>90% purity required)

    • Western blot confirmation using anti-His antibodies

    • Mass spectrometry verification

When scaling up, consider using tangential flow filtration before chromatography steps to concentrate the protein and remove small molecular weight contaminants.

How can researchers optimize the expression of recombinant ndhA protein in E. coli systems?

Optimizing expression of recombinant ndhA in E. coli requires systematic adjustment of multiple parameters:

  • Strain selection:

    • BL21(DE3) for standard expression

    • C41(DE3) or C43(DE3) for membrane proteins

    • Rosetta or CodonPlus strains if codon optimization is needed

  • Expression vector considerations:

    • pET series vectors with T7 promoter for high expression

    • pBAD vectors for tunable expression through arabinose induction

    • Cold-shock vectors for low-temperature expression

  • Culture conditions optimization:

    • Induction at OD600 of 0.6-0.8

    • Lower temperatures (16-25°C) for membrane proteins

    • Extended expression time (16-24 hours) at reduced temperatures

    • Inclusion of membrane-stabilizing additives (glycerol 5%, sorbitol 1M)

  • Induction protocol refinement:

    • IPTG concentration (0.1-0.5 mM)

    • Consider auto-induction media for gradual protein expression

    • Dual-phase protocols (growth at 37°C, induction and expression at 18°C)

Expressing ndhA as a membrane protein may benefit from co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ) to enhance proper folding and reduce inclusion body formation.

How does the His-tag affect the structural and functional properties of recombinant ndhA protein compared to native forms?

The His-tag influence on recombinant ndhA requires careful consideration:

  • Structural impacts:

    • N-terminal His-tags may disrupt secondary structure elements in the N-terminal region

    • Potential interference with membrane insertion or protein-protein interactions

    • Possible alteration of the native conformation, particularly in the tag-adjacent regions

  • Functional consequences:

    • Reduced catalytic efficiency (typically 5-15% decrease) compared to native enzyme

    • Altered substrate binding kinetics due to charge interactions from the tag

    • Modified protein-protein interaction landscape within multi-subunit complexes

  • Experimental validations needed:

    • Comparative enzymatic assays between tagged and tag-cleaved versions

    • Circular dichroism spectroscopy to assess secondary structure differences

    • Thermal stability analyses to detect conformational changes

  • Mitigation strategies:

    • Using TEV or PreScission protease cleavage sites for tag removal after purification

    • Positioning the tag at the C-terminus if N-terminal structure is critical

    • Inclusion of flexible linker sequences between the tag and protein

Researchers should validate that the His-tagged protein maintains physiologically relevant activity through appropriate controls comparing native and recombinant forms when possible .

What approaches can be used to reconstitute recombinant ndhA into artificial membrane systems for functional studies?

Reconstitution of ndhA into artificial membrane systems involves these methodological approaches:

  • Liposome incorporation:

    • Preparation of liposomes from plant lipid extracts or synthetic lipids (POPC, POPE)

    • Detergent-mediated reconstitution using controlled detergent removal

    • Techniques include dialysis, Bio-Beads adsorption, or gel filtration

    • Protein-to-lipid ratios between 1:50 and 1:200 (w/w) for optimal incorporation

  • Nanodiscs formation:

    • Co-assembly with membrane scaffold proteins (MSPs)

    • Provides defined membrane patches with controlled size

    • Advantageous for single-molecule studies and structural analyses

    • Requires optimization of ndhA:MSP:lipid ratios

  • Supported lipid bilayers:

    • Formation on solid supports (glass, mica, silicon)

    • Allows integration with surface-sensitive techniques

    • Enables lateral mobility measurements of reconstituted proteins

  • Functional validation:

    • Proton pumping assays using pH-sensitive fluorescent dyes

    • Electron transfer measurements with artificial electron donors/acceptors

    • Assessment of orientation using protease accessibility tests

These systems allow detailed investigation of ndhA function in defined membrane environments that mimic the native chloroplast membrane.

What are the current hypotheses regarding the role of ndhA in plant stress responses and photosynthetic efficiency?

Current hypotheses on ndhA's role in plant stress and photosynthesis include:

  • Drought stress response mechanisms:

    • NDH complex involvement in accelerating cyclic electron flow during water limitation

    • Maintenance of proton gradient across thylakoid membranes when stomatal conductance is reduced

    • Enhanced ATP/NADPH ratio to meet metabolic demands under stress

  • High light protection:

    • Prevention of over-reduction of electron transport chain components

    • Dissipation of excess reducing power through alternative electron flows

    • Regulation of reactive oxygen species production at photosystem I

  • Temperature adaptation:

    • Modified NDH activity at temperature extremes (both high and low)

    • Stabilization of photosynthetic machinery during temperature fluctuations

    • Potential role in chloroplast retrograde signaling during temperature stress

  • Evolutionary significance:

    • Conservation of ndhA across land plants but loss in some lineages

    • Species-specific adaptations in ndhA sequence correlating with environmental niches

    • Co-evolution with other components of photosynthetic machinery

These hypotheses are being investigated through comparative genomics, reverse genetics approaches, and physiological studies under controlled stress conditions.

What are common challenges in maintaining recombinant ndhA protein stability during in vitro experiments?

Challenges in maintaining ndhA stability include:

  • Aggregation issues:

    • Membrane proteins like ndhA tend to aggregate when removed from membrane environments

    • Prevention strategies include continuous presence of mild detergents (0.03-0.1% DDM)

    • Addition of stabilizing agents (glycerol 10%, sucrose 5%)

    • Working at protein concentrations below aggregation threshold (typically <2 mg/mL)

  • Oxidative damage:

    • Susceptibility to oxidation of critical cysteine residues

    • Maintenance of reducing environment with DTT or TCEP

    • Storage and handling under nitrogen atmosphere for sensitive experiments

    • Addition of antioxidants during long-term storage

  • Proteolytic degradation:

    • Use of protease inhibitor cocktails specific for E. coli-derived proteases

    • Maintaining sample purity to remove contaminating proteases

    • Storage at appropriate temperatures to minimize proteolysis

  • Activity loss kinetics:

    • Typical half-life of 3-7 days at 4°C in optimized buffer conditions

    • Activity loss of 5-10% per freeze-thaw cycle

    • Development of activity preservation protocols specific to experimental timeline

Researchers should validate protein integrity before each experiment through SDS-PAGE analysis or activity assays to ensure experimental reproducibility .

How can researchers troubleshoot low expression yields of recombinant ndhA in bacterial systems?

Troubleshooting low ndhA expression yields requires systematic investigation:

  • Expression construct evaluation:

    • Codon optimization for E. coli (CAI value >0.8)

    • Verification of correct reading frame and sequence integrity

    • Analysis of mRNA secondary structures in the 5' region

    • Testing alternative affinity tags (SUMO, MBP) for enhanced solubility

  • Host strain optimization:

    • Screening multiple E. coli strains (BL21, C41/C43, Rosetta, Arctic Express)

    • Consideration of strains with enhanced membrane protein expression capability

    • Use of specialized strains containing rare tRNAs

  • Culture conditions modification:

    • Reduced temperature induction protocols (16-20°C)

    • Altered media composition (2YT, TB, auto-induction media)

    • Addition of chemical chaperones (betaine, sorbitol)

    • Systematic variation of induction timing and inducer concentration

  • Analysis of expression bottlenecks:

    • Quantification of mRNA levels to identify transcriptional limitations

    • Assessment of protein stability using pulse-chase experiments

    • Evaluation of toxicity through growth curve analysis

    • Investigation of inclusion body formation versus membrane integration

Implementing a design of experiments (DOE) approach allows systematic testing of multiple parameters simultaneously to identify optimal expression conditions.

What are the methodological considerations for studying protein-protein interactions involving recombinant ndhA in vitro?

Studying ndhA protein-protein interactions requires specialized approaches:

  • Membrane-compatible co-immunoprecipitation:

    • Crosslinking optimization prior to solubilization (DSP, formaldehyde)

    • Detergent screening for complex preservation (digitonin, amphipol, nanodisc)

    • Stringency optimization in wash buffers to maintain specific interactions

    • Mass spectrometry analysis of co-precipitated proteins

  • Surface plasmon resonance adaptations:

    • Immobilization strategies preserving native ndhA conformation

    • Detergent-compatible sensor chips and running buffers

    • Control experiments to distinguish specific binding from non-specific detergent effects

    • Kinetic analysis of association/dissociation with potential interaction partners

  • Microscale thermophoresis considerations:

    • Fluorescent labeling at sites not involved in interaction interfaces

    • Buffer optimization to minimize non-specific interactions

    • Temperature gradients tailored to membrane protein stability ranges

    • Careful data interpretation accounting for detergent micelle effects

  • Functional reconstitution systems:

    • Co-reconstitution of multiple proteins into liposomes

    • Activity coupling assays to detect functional interactions

    • FRET-based approaches for proximity detection in membrane environments

These methodologies require careful controls to distinguish genuine interactions from artifacts caused by the hydrophobic nature of membrane proteins like ndhA.

How might structural studies of recombinant ndhA contribute to understanding photosynthetic electron transport mechanisms?

Structural studies of ndhA offer significant insights into photosynthetic electron transport through:

  • High-resolution structural determination approaches:

    • Cryo-electron microscopy of reconstituted NDH complexes

    • X-ray crystallography of stabilized ndhA protein

    • NMR studies of specific domains and interaction interfaces

  • Mechanistic insights to be gained:

    • Proton translocation pathways through the membrane domain

    • Conformational changes during electron transfer events

    • Subunit interaction dynamics within the NDH complex

    • Substrate binding sites and catalytic mechanisms

  • Structure-function correlations:

    • Identification of critical residues for enzyme activity through structure-guided mutagenesis

    • Understanding species-specific adaptations in protein structure

    • Elucidation of the molecular basis for environmental stress responses

  • Translational applications:

    • Design of modified photosynthetic complexes with enhanced efficiency

    • Identification of sites for directed evolution approaches

    • Development of small molecule modulators of NDH activity

Combining structural data with functional studies and computational simulations would provide a comprehensive understanding of the molecular mechanisms underlying ndhA function in photosynthetic electron transport.

What comparative genomic approaches can reveal evolutionary insights about ndhA across plant species?

Comparative genomic approaches for evolutionary ndhA analysis include:

  • Phylogenetic analysis methodologies:

    • Maximum likelihood and Bayesian inference approaches

    • Codon-based models accounting for synonymous versus non-synonymous substitutions

    • Integration of structural constraints in evolutionary models

    • Analysis of selection pressures using dN/dS ratios across lineages

  • Structural variation patterns:

    • Identification of conserved domains versus variable regions

    • Correlation of sequence conservation with functional importance

    • Analysis of lineage-specific insertions/deletions

    • Investigation of co-evolution patterns with interacting partners

  • Chloroplast genome context:

    • Synteny analysis across plant lineages

    • Investigation of gene loss events in specific plant groups

    • Correlation with ecological adaptations and photosynthetic strategies

    • Analysis of RNA editing sites affecting ndhA protein sequence

  • Experimental validation approaches:

    • Complementation studies in model systems

    • Functional characterization of ndhA variants from diverse species

    • Assessment of adaptation to different environmental conditions

These approaches can reveal how evolutionary processes have shaped ndhA function across plant lineages and identify key adaptations related to specific ecological niches.

What technical advances are needed to better understand the integration of recombinant ndhA into functional multi-subunit complexes?

Technical advances needed for understanding ndhA integration into complexes include:

  • Co-expression system development:

    • Polycistronic expression vectors for multiple NDH complex subunits

    • Development of plant-based heterologous expression systems

    • Inducible expression systems with controlled stoichiometry

    • In vitro translation systems incorporating membrane fractions

  • Advanced imaging methodologies:

    • Single-molecule fluorescence techniques for complex assembly monitoring

    • High-speed atomic force microscopy for dynamic structural changes

    • Super-resolution microscopy approaches for spatial organization

    • Time-resolved cryo-EM for capturing assembly intermediates

  • Interaction mapping technologies:

    • Hydrogen-deuterium exchange mass spectrometry compatible with membrane proteins

    • Cross-linking mass spectrometry with membrane-penetrating linkers

    • Proximity labeling approaches (BioID, APEX) in chloroplast environments

    • Native mass spectrometry of intact membrane protein complexes

  • Functional assay developments:

    • Microfluidic approaches for rapid screening of functional complexes

    • Single-complex activity measurements

    • Development of sensors for monitoring electron flow in reconstituted systems

    • Computational modeling of complex assembly pathways

These technical advances would bridge the gap between structural studies of individual subunits and understanding of the functional integrated complex in its native environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.