Recombinant Eucalyptus globulus subsp. globulus NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSVIPILAFXISGILAPISKGPEKLSSYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially the chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of ndhC in the NAD(P)H:quinone oxidoreductase complex?

The ndhC protein functions as a subunit of the NAD(P)H:quinone oxidoreductase complex (NDH-1) in chloroplasts. This complex plays a pivotal role in:

  • Cyclic electron flow (CEF) around Photosystem I

  • Respiratory electron transfer

  • Carbon concentration mechanisms (CCM) in photosynthetic organisms

The NDH-1 complex couples electron transport from ferredoxin (Fd) to plastoquinone (PQ) with proton pumping from the cytoplasm to the lumen, driving ATP production . This energy-coupling mechanism is crucial for maintaining optimal ATP/NADPH ratios, especially under stress conditions. The ndhC subunit specifically contributes to the formation of the membrane arm of the complex, which is essential for proton translocation across the thylakoid membrane .

How does ndhC differ between Eucalyptus species and other plants?

While the core function of ndhC is conserved across photosynthetic organisms, there are notable differences between species. In Eucalyptus species, the protein maintains high sequence conservation, but there are species-specific variations that may correlate with environmental adaptations.

Comparative analysis shows:

  • The protein is highly conserved across Eucalyptus species (>90% sequence identity)

  • Minor variations occur primarily in non-functional regions

  • Some variations may correlate with different growth characteristics or stress responses observed in different Eucalyptus species

  • Unlike some cyanobacterial NDH-1 complexes, the Eucalyptus ndhC does not associate with certain additional subunits (such as NdhP and NdhQ) that have been identified in organisms like Thermosynechococcus elongatus

What are the recommended methods for recombinant expression of Eucalyptus globulus ndhC?

For successful recombinant expression of E. globulus ndhC, researchers should consider the following methodology:

  • Expression System Selection: E. coli has proven effective for expressing ndhC, as demonstrated by commercial sources . For a membrane protein like ndhC, E. coli strains optimized for membrane proteins (such as C41/C43) are recommended.

  • Vector Design:

    • Include a His-tag (preferably N-terminal) for purification

    • Codon optimization for the expression system

    • Consider fusion partners to improve solubility

    • Include appropriate promoters (T7 is commonly used)

  • Expression Conditions:

    • Induction at lower temperatures (16-25°C) to facilitate proper folding

    • Extended expression time (overnight)

    • IPTG concentration typically between 0.1-0.5 mM

    • Consider supplementing with membrane-supporting components

  • Purification Strategy:

    • Membrane fractionation

    • Solubilization using mild detergents (DDM or LDAO)

    • Affinity chromatography using the His-tag

    • Size exclusion chromatography for final polishing

  • Storage Conditions:

    • Storage buffer containing Tris/PBS-based buffer with 50% glycerol at pH 8.0

    • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

What analytical methods are most effective for assessing ndhC activity?

Several complementary methods can be used to assess ndhC activity:

  • Spectrophotometric Assays:

    • Monitor NAD(P)H oxidation at 340 nm

    • Typical reaction mixtures contain 50 µM quinone, 500 µM NAD(P)H, and enzyme in 20 mM Tris-HCl pH 8, 100 mM NaCl, 5% (v/v) DMSO

    • Rates can be determined by monitoring the change in optical density over time

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation with other NDH-1 complex subunits

    • Yeast two-hybrid or bacterial two-hybrid systems

    • Blue native PAGE to assess complex formation

  • Electron Microscopy:

    • Negative staining for initial complex visualization

    • Cryo-EM for high-resolution structural analysis

    • Single particle averaging to locate ndhC within the NDH-1 complex

  • Functional Reconstitution:

    • Incorporation into liposomes

    • Measurement of quinone reduction in the reconstituted system

    • Proton gradient formation assessment

  • In vivo Analysis:

    • Complementation studies in knockout mutants

    • Fluorescence measurements of NAD(P)H oxidation

    • P700 redox kinetics to assess cyclic electron flow

How does ndhC contribute to stress responses in Eucalyptus?

The ndhC protein plays a critical role in stress adaptation in Eucalyptus species through its function in the NDH-1 complex:

  • Drought Stress Response:

    • Enhances cyclic electron flow to increase ATP production without additional NADPH

    • Helps maintain photosynthetic efficiency under water deficit conditions

    • Contributes to non-photochemical quenching to prevent photodamage

  • Nutrient Stress Adaptation:

    • In nutrient-limited conditions, the NDH-1 complex helps optimize energy production

    • Different Eucalyptus genotypes show varying expression patterns of NDH-related genes under nutrient stress, suggesting genotype-specific adaptation mechanisms

  • Oxidative Stress Protection:

    • The NDH-1 complex helps prevent over-reduction of the electron transport chain

    • Reduces formation of reactive oxygen species

    • Works in conjunction with other antioxidant systems

  • Temperature Stress:

    • Plays a role in maintaining photosynthetic efficiency under temperature extremes

    • Contributes to thylakoid membrane stability

Research has demonstrated that genotype-specific differences in NDH-related gene expression correlate with varying stress tolerance levels in Eucalyptus species , suggesting that ndhC function may be one factor determining environmental adaptation capabilities.

What is the relationship between ndhC function and recombination rates in Eucalyptus?

Studies on genome-wide variation in recombination rates in Eucalyptus have revealed interesting correlations that may indirectly relate to ndhC function:

  • Genomic Context:

    • Recombination rates in Eucalyptus vary significantly between chromosomes (1.98 to 3.81 cM/Mb)

    • Recombination hotspots correlate with gene density, which may affect evolutionary patterns of genes like ndhC

  • Evolutionary Implications:

    • Chromosomal recombination rate negatively correlates with average genetic diversity (r = -0.75)

    • This suggests selective pressure on functional genes, potentially including those involved in energy metabolism like ndhC

  • Conservation Patterns:

    • The conservation of genome architecture across Eucalyptus lineages suggests stable evolutionary contexts for key functional genes

    • This may explain the high conservation of ndhC sequence across Eucalyptus species despite chromosomal variation in recombination rates

While a direct causal relationship between ndhC function and recombination rates has not been established, these genomic patterns provide context for understanding the evolutionary stability of this important functional gene.

How can researchers effectively study protein-protein interactions within the NDH-1 complex involving ndhC?

To elucidate the protein-protein interactions involving ndhC within the larger NDH-1 complex, researchers should consider these advanced methodological approaches:

  • Cryo-EM Structure Determination:

    • High-resolution structural analysis using cryo-EM, as demonstrated with NDH-1L from cyanobacteria

    • Single particle analysis to identify the position of ndhC within the complex

    • Cross-linking mass spectrometry to identify interacting regions

  • GFP-Fusion Experiments:

    • C-terminal fusion of ndhC with superfolder GFP

    • Purification of the complex followed by electron microscopy

    • Single particle averaging to reveal the location of ndhC within the complex

  • Site-Directed Mutagenesis:

    • Systematic mutation of conserved residues in ndhC

    • Assessment of complex assembly and function

    • Identification of critical interaction points

  • Complementation Studies:

    • Generate knockout/knockdown lines for ndhC

    • Complement with modified versions to assess functional regions

    • Evaluate phenotypic responses to stress conditions

  • Advanced Interaction Proteomics:

    • Proximity labeling approaches (BioID or APEX)

    • Quantitative crosslinking-mass spectrometry

    • Hydrogen-deuterium exchange mass spectrometry

An example from related research shows the successful use of GFP fusion with an NDH subunit (NdhP) to determine its location within the NDH-1L complex, revealing its presence in the distal unit formed by NdhD1 and NdhF1 . Similar approaches could be applied to ndhC in Eucalyptus.

What are the current challenges in studying electron transport mechanisms involving ndhC?

Researchers face several significant challenges when investigating the detailed electron transport mechanisms involving ndhC:

  • Structural Complexity:

    • The NDH-1 complex exists in multiple forms (NDH-1L, NDH-1MS, NDH-1MS') with different subunit compositions

    • Distinguishing the specific contribution of ndhC within the larger complex remains difficult

    • The membrane-embedded nature of ndhC presents technical challenges for structural studies

  • Functional Redundancy:

    • Alternative electron transport pathways may compensate for experimental perturbations

    • Distinguishing between direct and indirect effects of ndhC modification is challenging

  • Technical Limitations:

    • Difficulty in obtaining sufficient quantities of functional recombinant protein

    • Challenges in maintaining native membrane protein structure during purification

    • Limited availability of specific antibodies for Eucalyptus ndhC

  • Species-Specific Variations:

    • Differences between model organisms and Eucalyptus may limit applicability of established methods

    • Variable expression levels depending on environmental conditions complicate standardization

  • Integration with Other Processes:

    • The NDH complex participates in both cyclic electron flow and respiration

    • Disentangling these processes experimentally requires sophisticated approaches

Recent research has made progress in addressing some of these challenges through advanced structural studies of related NDH complexes, revealing details such as the PQ binding chamber and electron transport pathways from ferredoxin to plastoquinone .

How does the structure of the PQ binding chamber in NDH complexes containing ndhC influence electron transport efficiency?

The structure of the plastoquinone (PQ) binding chamber is critical for electron transport efficiency in NDH complexes:

  • Structural Features:

    • The PQ chamber is located at the interface of the membrane and hydrophilic arms of the complex

    • Key structural elements include the four-helix bundle region and β1-2 loop of NdhH, fragments of NdhK, and the TMH5-6 loop of NdhA

    • These elements are stabilized by multiple subunits including ndhC

  • Functional Implications:

    • The distance between PQ and the N2 iron-sulfur cluster is critical (approximately 18 Å in studied structures)

    • Conformational changes in the β1-2 loop of NdhH can significantly affect the size and accessibility of the PQ chamber

    • These changes may represent different functional states of the complex

  • Electron Transfer Mechanism:

    • Electron transfer from the N2 cluster to PQ requires specific interactions with conserved residues

    • Key residues identified include H23 and Y72 of NdhH (in cyanobacterial NDH-1L)

    • The hydrogen bond network involving these residues is essential for protonation during the catalytic cycle

  • Species-Specific Variations:

    • Comparative analysis suggests differences in PQ chamber structure between species

    • These variations may correlate with differences in electron transport efficiency

    • Adaptation to different environmental conditions may drive these structural variations

Research on cyanobacterial NDH-1L has shown that the PQ chamber can adopt different conformations representing various functional states, with implications for understanding similar mechanisms in Eucalyptus ndhC-containing complexes .

What genomic features influence the expression and evolution of ndhC in Eucalyptus species?

Several genomic features influence ndhC expression and evolution in Eucalyptus:

  • Genome Architecture:

    • The Eucalyptus genome contains distinctive features that affect gene expression patterns

    • A large inversion of ~56 kb in the LSC region of the plastid genome affects the order of genes between rbcL and trnQ-UUG, potentially influencing expression of chloroplast genes like ndhC

    • Tandem repeat structures in the plastome may influence gene expression regulation

  • Recombination Patterns:

    • Variation in recombination rates between individuals (2.71 to 3.51 cM/Mb) and between chromosomes (1.98 to 3.81 cM/Mb) in Eucalyptus genomes

    • Strong correlation between recombination rate and gene density (r = 0.94), GC content (r = 0.90), and number of tandem duplicated genes (r = -0.72)

    • These patterns may influence the evolutionary trajectory of functional genes like ndhC

  • Selection Pressures:

    • Negative correlation between chromosomal recombination rate and genetic diversity (r = -0.75)

    • This suggests purifying selection on genes in regions with high recombination rates

    • Functional constraint on energy metabolism genes like ndhC likely maintains high sequence conservation

  • Conservation Across Species:

    • Genome architecture appears broadly conserved across globally significant Eucalyptus lineages

    • This conservation extends to chloroplast genes like ndhC, suggesting strong functional constraints

How do different Eucalyptus genotypes respond to nutrient stress in terms of NDH complex gene expression?

Research on Eucalyptus urophylla has revealed genotype-specific responses to nutrient stress that affect NDH complex gene expression:

  • Genotype-Specific Responses:

    • High-growth cultivars (e.g., ZQUA44) and low-growth cultivars (e.g., ZQUB15) show distinct transcriptomic responses to nutrient limitation

    • Different sets of differentially expressed genes (DEGs) are activated in response to nutrient stress between genotypes

  • Metabolic Pathway Differences:

    • DEGs involved in glutathione metabolism and flavonoid biosynthesis appear to respond to nutrient starvation across genotypes

    • DEGs involved in carotenoid biosynthesis and starch/sucrose metabolism show genotype-specific responses

  • Transcription Factor Involvement:

    • MYB-related family transcription factors appear responsive to nutrient deficiency across genotypes

    • B3 transcription factors show different functions in different genotypes under stress

  • Energy Metabolism Adaptation:

    • Different expression patterns of genes related to energy metabolism, including NDH complex components

    • These differences likely contribute to the variable growth performance under nutrient limitation

This research demonstrates that genotype-specific pathway regulation may be a key mechanism for adaptation to environmental stresses in Eucalyptus species, with implications for understanding the variable roles of NDH components like ndhC.

What are the optimal conditions for assessing NDH activity in Eucalyptus tissue samples?

Optimal conditions for assessing NDH activity in Eucalyptus tissue samples require careful consideration of several factors:

  • Sample Preparation:

    • Young, fully expanded leaves yield the best results

    • Flash-freeze samples in liquid nitrogen immediately after collection

    • Grind tissue to a fine powder while maintaining freezing temperatures

    • Use appropriate buffer systems (typically 50 mM HEPES-KOH pH 7.5, 330 mM sorbitol, 1 mM MgCl2, 2 mM EDTA, with protease inhibitors)

  • Thylakoid Isolation:

    • Differential centrifugation to isolate intact chloroplasts

    • Osmotic shock to release thylakoid membranes

    • Careful resuspension in measurement buffer

  • Activity Measurement Methods:

    • P700 oxidation-reduction kinetics using dual-wavelength spectrophotometry

    • Chlorophyll fluorescence measurements (particularly post-illumination fluorescence rise)

    • NAD(P)H oxidation monitoring at 340 nm for in vitro assays

    • Artificial electron acceptors like ferricyanide or dichlorophenolindophenol (DCPIP)

  • Reaction Conditions:

    • Temperature: 25°C is typically optimal

    • pH: 7.5-8.0 for most assays

    • Light conditions: Pre-illumination followed by darkness for post-illumination measurements

    • Inhibitors: Antimycin A to block cyclic electron flow through the PGR5 pathway

  • Controls and Calibration:

    • Include inhibitor controls (rotenone for complex I inhibition)

    • Standard curves with known concentrations of NAD(P)H

    • Comparison with model systems when possible

For spectrophotometric assays specifically, reaction mixtures containing 50 µM quinone, 500 µM NAD(P)H, and enzyme preparation in 20 mM Tris-HCl pH 8, 100 mM NaCl, 5% (v/v) DMSO have been successfully used for related quinone oxidoreductases .

How can researchers distinguish between the different types of NDH complexes in Eucalyptus chloroplasts?

Distinguishing between different NDH complex types in Eucalyptus chloroplasts requires a combination of techniques:

  • Blue Native PAGE Separation:

    • Allows separation of intact complexes based on size

    • Can resolve NDH-1L (~450 kDa) from NDH-1MS and NDH-1MS' complexes

    • Western blotting with specific antibodies can confirm identity of separated complexes

    • Example: NdhP was identified as a unique component of NDH-1L (450 kDa) but not detectable in NDH-1MS or NDH-1MS' complexes

  • Subunit-Specific Antibodies:

    • Develop antibodies against subunits unique to specific complex types

    • Western blotting following native or denaturing electrophoresis

    • Immunoprecipitation to isolate specific complex types

  • Functional Differentiation:

    • NDH-1L functions in respiration and cyclic electron flow at high CO2

    • NDH-1MS and NDH-1MS' are involved in carbon concentration

    • Measure activity under conditions that favor specific functions

  • Tagging Approaches:

    • GFP fusion with specific subunits to track complex assembly

    • Purification via affinity tags followed by mass spectrometry

    • Example: C-terminal fusion of NdhP with his-tagged GFP allowed purification and localization within the NDH-1L complex

  • Mass Spectrometry Analysis:

    • Intact complex analysis

    • Subunit composition determination

    • Post-translational modification identification

This multi-technique approach has been successfully applied to cyanobacterial NDH-1 complexes and can be adapted for Eucalyptus studies .

What are the methodological considerations for studying quinone reduction by recombinant NAD(P)H oxidoreductases?

When studying quinone reduction by recombinant NAD(P)H oxidoreductases like ndhC-containing complexes, researchers should consider these methodological aspects:

  • Enzyme Preparation:

    • Purify to >90% homogeneity using appropriate chromatography techniques

    • Maintain in storage buffer containing 50% glycerol at pH 8.0

    • Avoid repeated freeze-thaw cycles

    • Determine protein concentration accurately using Bradford or BCA assays

  • Substrate Selection:

    • Choose appropriate quinone substrates (benzoquinones or naphthoquinones)

    • Consider solubility in aqueous buffers (typically requiring 5% DMSO)

    • Use physiologically relevant quinones where possible (plastoquinone for chloroplastic enzymes)

  • Reaction Monitoring:

    • Track NAD(P)H oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Use UV-transparent 96-well plates for high-throughput screening

    • Monitor using a spectrophotometer with temperature control capability

  • Reaction Conditions:

    • Standard reaction mixture: 50 µM quinone, 500 µM NAD(P)H, 0.1-10 µg enzyme in buffer

    • Buffer composition: 20 mM Tris-HCl pH 8, 100 mM NaCl, 5% (v/v) DMSO

    • Include appropriate controls (no enzyme, no substrate)

    • Initiate reaction by adding enzyme/NAD(P)H solution to quinone

  • Data Analysis:

    • Calculate initial rates from linear portion of progress curves

    • Determine kinetic parameters (Km, Vmax) using appropriate models

    • Compare substrate preferences using standardized conditions

  • Potential Pitfalls:

    • Quinone auto-oxidation/reduction - control for this

    • Enzyme stability over assay period

    • Optimal detergent concentration for membrane proteins

    • Inhibition at high substrate concentrations

Different NAD(P)H quinone oxidoreductases from the same organism may have complementary substrate specificity profiles, making comparative analysis valuable .

How does the NDH complex contribute to anti-inflammatory properties observed in Eucalyptus extracts?

Studies on Eucalyptus globulus leaf extracts have demonstrated anti-inflammatory properties that may partially relate to NDH complex components:

  • Observed Anti-inflammatory Effects:

    • Aqueous extracts of E. globulus leaves have been shown to reduce inflammation parameters in animal models

    • Treatment with these extracts resulted in decreased levels of inflammatory markers including C-reactive protein (CRP) and tumor necrosis factor (TNF)

  • Potential Mechanisms Involving NDH:

    • NDH complex activity influences cellular redox status

    • Proper electron transport prevents excessive reactive oxygen species (ROS) formation

    • Maintenance of optimal energy metabolism supports anti-inflammatory processes

  • Bioactive Compounds and Their Interaction with NDH:

    • Essential oils from E. globulus leaves, particularly eucalyptol, have demonstrated anti-inflammatory properties

    • These compounds may stabilize membrane systems where NDH complexes function

    • Antioxidant components like α-pinene, β-pinene, and limonene may work synergistically with NDH-mediated processes

  • Experimental Evidence:

    • In experimental models, E. globulus extract treatment normalized levels of white blood cells, including neutrophils and monocytes

    • Reduction in CRP and TNF levels suggests modulation of inflammatory pathways

    • These effects may be partially mediated through optimization of energy metabolism involving NDH complexes

What methods can be used to assess the impact of environmental stressors on NDH complex function in Eucalyptus?

To assess the impact of environmental stressors on NDH complex function in Eucalyptus, researchers can employ several complementary approaches:

  • Chlorophyll Fluorescence Analysis:

    • Measure post-illumination fluorescence rise (PIFR)

    • PAM (Pulse Amplitude Modulation) fluorometry to assess NDH activity

    • Analyze NPQ (Non-Photochemical Quenching) parameters under stress conditions

    • Compare quantum yield of PSI and PSII to evaluate electron flow balance

  • Transcriptomic Approaches:

    • RNA-Seq analysis under varying stress conditions

    • qRT-PCR for targeted NDH subunit expression analysis

    • Compare expression patterns between different genotypes

    • Example: Different E. urophylla genotypes showed distinct transcriptomic responses to nutrient stress

  • Proteomic Analysis:

    • Western blotting for key NDH subunits

    • Blue native PAGE to assess complex integrity

    • Mass spectrometry to identify post-translational modifications

    • Quantitative proteomics to measure changes in subunit stoichiometry

  • Physiological Measurements:

    • Gas exchange parameters (photosynthetic rate, transpiration)

    • P700 redox kinetics to assess cyclic electron flow

    • Growth parameters under controlled stress conditions

    • Water use efficiency measurements

  • Biochemical Assays:

    • NAD(P)H oxidation rates in isolated thylakoids

    • ROS measurement under stress conditions

    • Antioxidant enzyme activities

    • ATP/NADPH ratio determination

  • Genetic Approaches:

    • Comparison of different Eucalyptus genotypes under identical stress conditions

    • Correlation of NDH function with stress tolerance phenotypes

    • Example: High-growth and low-growth E. urophylla cultivars showed different responses to nutrient limitation

Integration of these methods provides a comprehensive assessment of how environmental stressors impact NDH complex function across different levels of biological organization.

What emerging technologies are most promising for advancing our understanding of ndhC function?

Several emerging technologies show exceptional promise for advancing our understanding of ndhC function:

These technologies, especially when used in combination, have the potential to overcome current limitations in studying membrane-embedded components like ndhC.

How might insights from cyanobacterial NDH complex research be applied to understanding Eucalyptus ndhC function?

Research on cyanobacterial NDH complexes provides valuable insights that can be applied to understanding Eucalyptus ndhC function:

  • Structural Insights:

    • Cryo-EM structures of cyanobacterial NDH-1L complexes reveal detailed binding pockets for electron donors and acceptors

    • The location and orientation of plastoquinone in the binding pocket provides a framework for understanding quinone reduction mechanisms

    • These structural models can guide investigations of analogous components in Eucalyptus

  • Subunit Functions and Interactions:

    • Studies in cyanobacteria have identified specialized roles for different NDH complex subunits

    • For example, NdhV has been shown to regulate ferredoxin binding and influence cyclic electron flow activity

    • Similar regulatory mechanisms may exist in Eucalyptus NDH complexes

  • Electron Transport Mechanisms:

    • Detailed electron transport pathways from ferredoxin to plastoquinone have been mapped in cyanobacterial systems

    • The coupling mechanism between electron transport and proton pumping is being elucidated

    • These fundamental mechanisms likely apply to Eucalyptus with species-specific adaptations

  • Methodological Approaches:

    • Successful techniques for isolating and characterizing cyanobacterial NDH complexes, such as GFP tagging and single particle analysis , can be adapted for Eucalyptus studies

    • Comparative genomics approaches can identify conserved and divergent features

  • Stress Response Patterns:

    • Cyanobacterial NDH complexes have well-characterized roles in stress responses

    • Similar functional roles in stress adaptation are likely conserved in Eucalyptus

    • Understanding these parallels can guide experimental design for Eucalyptus studies

By applying the lessons learned from cyanobacterial research while accounting for the unique features of the Eucalyptus chloroplast system, researchers can accelerate progress in understanding ndhC function in this important tree species.

What are the potential implications of ndhC research for improving Eucalyptus stress tolerance?

Research on ndhC has several potential implications for improving Eucalyptus stress tolerance:

  • Genetic Selection Strategies:

    • Identification of favorable ndhC variants associated with enhanced stress tolerance

    • Development of molecular markers for marker-assisted selection

    • Screening of germplasm collections for natural variations that enhance NDH function

    • Selection of genotypes with optimized NDH complex regulation under stress conditions

  • Genetic Engineering Approaches:

    • Targeted modification of ndhC or its regulatory elements to enhance function

    • Overexpression of limiting components in the NDH complex

    • Engineering of improved electron transport efficiency

    • These modifications could enhance energy balance under stress conditions

  • Physiological Interventions:

    • Development of treatments that enhance NDH complex stability or assembly

    • Optimization of growing conditions to maximize NDH function during stress periods

    • Priming approaches to pre-activate stress response pathways involving NDH

    • These strategies could be implemented in forestry practices

  • Predictive Models:

    • Integration of ndhC function into models predicting Eucalyptus performance under climate change

    • Identification of high-risk conditions where NDH function becomes limiting

    • These models could guide forest management decisions

  • Interactions with Other Stress Response Systems:

    • Understanding how NDH-mediated processes interact with other stress responses

    • Coordinated enhancement of multiple protective mechanisms

    • This integrated approach could provide more robust stress tolerance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.