Recombinant Eucalyptus globulus subsp. globulus NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast Metabolism

NDH (NAD(P)H dehydrogenase) complexes, including ndhG, are integral to cyclic electron flow around Photosystem I (PSI) and chlororespiration .

Mechanistic Insights

  • Electron Transport: Accepts electrons from NAD(P)H and transfers them to plastoquinone via FMN and iron-sulfur clusters .

  • Proton Translocation: Couples electron transfer with proton pumping, contributing to ATP synthesis .

  • Evolutionary Conservation: The ndhG gene is absent in gymnosperms like Pinus but conserved in angiosperms, including Eucalyptus and Populus .

Comparative Genomics

SpeciesndhG StatusGenome Size (bp)Notable Features
Eucalyptus globulusPresent160,286Co-linear with Populus trichocarpa .
Pinus spp.Absent~120,000Lacks functional ndh genes; divergent structure .

Biochemical Studies

Recombinant ndhG is used to:

  1. Characterize NDH complex assembly and electron transport kinetics .

  2. Study plastid evolution through comparative genomics .

Biotechnological Relevance

  • Antioxidant Potential: Extracts from E. globulus (rich in redox-active compounds) show antioxidant activity, though direct links to ndhG require further study .

  • Drug Delivery Enhancement: E. globulus leaf oil enhances dermal penetration of compounds like chlorhexidine digluconate, suggesting synergistic applications .

Challenges and Future Directions

  • Functional Redundancy: NDH complexes in angiosperms may compensate for mitochondrial respiratory deficiencies .

  • Structural Biology: No crystallographic data exists for ndhG; resolving its 3D structure could elucidate substrate-binding sites .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLILGSLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAA AQLLIYVGAINILILFAVMFMNGSEYYKDLNLWTVGDGITSLVCTSILVSLMTTILDTSW YGIIWTTKSNQIIEQDLIGNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of NAD(P)H-quinone oxidoreductase subunit 6 in Eucalyptus chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a critical component of the chloroplast NAD(P)H dehydrogenase complex in Eucalyptus globulus. This protein participates in cyclic electron flow around photosystem I, contributing to ATP synthesis without net NADPH production. Similar to the characterized protein in other plant species, the ndhG subunit in E. globulus likely functions within a membrane-bound complex where it helps catalyze electron transfer from NAD(P)H to plastoquinone. This process is particularly important under environmental stress conditions, including drought, high light intensity, and low fertility conditions that are common in Eucalyptus plantations .

What expression systems are most effective for recombinant production of Eucalyptus globulus ndhG?

For laboratory-scale production of recombinant E. globulus ndhG, Escherichia coli expression systems have demonstrated the greatest efficacy, similar to those used for other plant chloroplastic proteins . The methodology involves:

  • Gene synthesis or amplification from E. globulus chloroplast DNA

  • Cloning into a suitable expression vector (pET series vectors with N-terminal His-tags are commonly employed)

  • Transformation into E. coli expression strains (BL21(DE3) or Rosetta)

  • Induction with ISOPROPYL β-D-1-thiogalactopyranoside (IPTG) at concentrations between 0.1-1.0 mM

  • Expression at reduced temperatures (16-20°C) to enhance proper folding

For plant-based expression, Agrobacterium-mediated transformation systems have been developed for Eucalyptus species, which could potentially be adapted for homologous expression of ndhG .

What are the optimal purification protocols for recombinant Eucalyptus globulus ndhG protein?

Purification of recombinant E. globulus ndhG protein presents unique challenges due to its hydrophobic nature and membrane association. A recommended purification protocol involves:

  • Cell lysis using sonication or French press in Tris/PBS-based buffer (pH 8.0) containing mild detergents (0.5-1% n-dodecyl β-D-maltoside)

  • Initial clarification by centrifugation at 10,000 × g

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Washing with increasing imidazole concentrations (20-50 mM)

  • Elution with high imidazole (250-300 mM)

  • Size exclusion chromatography for final polishing

  • Storage in buffer containing 6% trehalose to maintain stability

Protein purity should be assessed by SDS-PAGE and should exceed 90% for most research applications. Storage recommendations include aliquoting and maintaining at -80°C, as repeated freeze-thaw cycles significantly reduce activity .

How can researchers overcome stability challenges when working with recombinant ndhG protein?

Stability challenges with recombinant E. globulus ndhG can be addressed through:

Stabilization ApproachMethodologyEffectiveness
Addition of glycerol5-50% final concentrationHigh - Prevents aggregation during freezing
Trehalose inclusion5-10% in storage bufferHigh - Preserves protein structure
Reduced temperature4°C for short-term; -80°C for long-termEssential - Slows degradation
Mild detergentsn-dodecyl β-D-maltoside (0.05-0.1%)Moderate - Maintains native conformation
Avoiding freeze-thawAliquoting before freezingCritical - Prevents denaturation

Research indicates that reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL followed by addition of glycerol (final concentration 50%) provides optimal stability for long-term storage .

What experimental approaches effectively assess the functional activity of recombinant Eucalyptus globulus ndhG?

Functional characterization of recombinant E. globulus ndhG requires specialized assays due to its role in electron transport chains. Recommended approaches include:

  • Electron transport assays using artificial electron acceptors (e.g., dichlorophenolindophenol)

  • Reconstitution into liposomes for membrane-associated activity measurements

  • NADH/NADPH oxidation assays monitoring absorbance changes at 340 nm

  • Complementation studies in model organisms with ndhG mutations

  • In vitro assembly assays with other NAD(P)H dehydrogenase complex components

These functional assays must be performed under controlled redox conditions, typically using anaerobic chambers or oxygen-scavenging systems to prevent interference from reactive oxygen species.

How does ndhG expression in Eucalyptus globulus correlate with nitrogen utilization efficiency?

Research on E. globulus has demonstrated significant relationships between chloroplast function and nitrogen utilization. Studies investigating nitrogen loading in E. globulus seedlings reveal that plants grown under varying nitrogen concentrations (50-600 mg N L⁻¹) show corresponding changes in chloroplast development and function . While direct measurements of ndhG expression were not reported, related research suggests:

These findings suggest that ndhG expression likely follows similar patterns, with potential implications for stress tolerance in E. globulus plantations established on poor-quality sites.

What techniques are most effective for genetic transformation of Eucalyptus to modulate ndhG expression?

For genetic modification of ndhG expression in Eucalyptus species, several transformation approaches have shown promise:

  • Agrobacterium-mediated transformation remains the gold standard, with recent protocols achieving improved efficiency in Eucalyptus species

  • Regeneration systems utilizing organogenesis from leaf or stem explants provide the foundation for transformation

  • Selectable markers such as kanamycin or hygromycin resistance genes facilitate identification of transformed tissues

  • For chloroplast-targeted expression, transit peptide sequences must be incorporated into transformation constructs

  • CRISPR/Cas9 systems are emerging as valuable tools for precise editing of nuclear genes affecting chloroplast function

The specific regeneration protocols must be optimized for E. globulus, as significant variation in transformation efficiency exists among Eucalyptus genotypes .

How can comparative analysis of ndhG across Eucalyptus species inform evolutionary adaptations to environmental stress?

Comparative analysis of ndhG across Eucalyptus species offers valuable insights into evolutionary adaptations to environmental stressors. Researchers should consider the following methodological approaches:

  • Phylogenetic analysis of ndhG sequences from multiple Eucalyptus species adapted to different environments

  • Correlation of sequence variations with habitat parameters (rainfall, temperature extremes, soil fertility)

  • Site-directed mutagenesis to introduce species-specific variations into recombinant proteins

  • Functional characterization under simulated stress conditions (drought, high light, temperature extremes)

These approaches can reveal how structural variations in ndhG contribute to the remarkable adaptability of Eucalyptus species across diverse ecological niches, from high-rainfall forests to arid woodlands.

What are the common pitfalls in recombinant expression of membrane-associated chloroplast proteins like ndhG?

Researchers frequently encounter challenges when expressing membrane-associated chloroplast proteins like ndhG. Common issues and solutions include:

ChallengeCauseSolution
Inclusion body formationHydrophobic protein domainsLower expression temperature (16-18°C); use solubility tags (SUMO, MBP)
Low expression yieldsCodon bias; toxicity to hostCodon optimization; use tightly regulated expression systems
Protein aggregationImproper foldingAdd molecular chaperones (GroEL/ES); include mild detergents
Loss of functionImproper disulfide formationInclude reducing agents; express in specialized strains
Proteolytic degradationRecognition by host proteasesInclude protease inhibitors; use protease-deficient strains

Additionally, researchers should consider expressing truncated versions of the protein that exclude transmembrane domains if structural studies are the primary objective .

How can researchers differentiate between native and recombinant ndhG in experimental systems?

Differentiating between native and recombinant ndhG protein in experimental systems requires carefully designed approaches:

  • Epitope tagging: Use of His, FLAG, or other epitope tags on recombinant protein allows specific detection via immunoblotting

  • Size differentiation: Recombinant proteins with fusion tags will migrate differently on SDS-PAGE

  • Mass spectrometry: Peptide mass fingerprinting can identify species-specific sequence variations

  • Heterologous expression: Expression in non-plant systems eliminates contamination with native protein

  • Isotope labeling: Expression in media containing stable isotopes (¹⁵N, ¹³C) allows discrimination by mass

For in vivo studies, researchers should consider using fluorescent protein fusions while recognizing that these may affect protein localization or function in some cases.

What analytical methods best resolve conflicting data in functional studies of recombinant ndhG?

When faced with conflicting experimental results in ndhG functional studies, researchers should employ a systematic approach including:

  • Cross-validation using orthogonal techniques:

    • Combine spectroscopic, electrochemical, and genetic approaches

    • Validate in vitro findings with in vivo experiments

  • Rigorous control experiments:

    • Include inactive protein variants (site-directed mutants)

    • Test for interference from buffer components or contaminants

  • Comprehensive characterization of protein preparations:

    • Assess protein folding using circular dichroism

    • Verify complex assembly using native gel electrophoresis

    • Confirm redox state of prosthetic groups

  • Statistical approaches:

    • Employ larger sample sizes to increase statistical power

    • Use Bayesian approaches to reconcile seemingly conflicting datasets

  • Independent replication:

    • Have different researchers repeat critical experiments

    • Collaborate with laboratories using different methodologies

These approaches help distinguish genuine biological complexity from experimental artifacts that might otherwise lead to misinterpretation of ndhG function in Eucalyptus chloroplasts.

How might structural modifications to recombinant ndhG enhance stress tolerance in Eucalyptus?

Engineering enhanced stress tolerance in Eucalyptus through structural modifications of ndhG represents an advanced research frontier. Promising approaches include:

  • Targeted amino acid substitutions based on comparative analysis of ndhG from stress-tolerant species

  • Domain swapping with homologous proteins from extremophiles

  • Modification of regulatory regions to enhance expression under stress conditions

  • Engineering altered redox sensitivity to optimize electron transport under fluctuating conditions

These approaches could be particularly valuable for improving E. globulus performance on poor, low fertility sites where seedling performance is often compromised during the first field season . Research indicates that enhanced chloroplast function correlates strongly with improved stress tolerance in plantation species.

What omics approaches provide the most comprehensive insights into ndhG function in the context of the chloroplast NAD(P)H dehydrogenase complex?

Multi-omics approaches offer powerful tools for understanding ndhG function within the broader context of chloroplast biology:

Omics ApproachMethodologyInsights Provided
TranscriptomicsRNA-Seq under varied conditionsCoordination of ndhG expression with other complex components
ProteomicsLC-MS/MS with membrane enrichmentComplex assembly, post-translational modifications
MetabolomicsGC-MS or LC-MS of metabolite profilesImpact on chloroplast redox status and energy metabolism
InteractomicsCo-immunoprecipitation, yeast two-hybridProtein-protein interactions within the complex
PhenomicsHigh-throughput phenotypingWhole-plant consequences of ndhG modification

How does the function of ndhG in Eucalyptus compare to its role in pathogenic fungi affecting Eucalyptus plantations?

An intriguing research direction involves comparative analysis of plant ndhG and related proteins in pathogenic fungi affecting Eucalyptus, such as Calonectria species:

  • While both proteins participate in electron transport chains, they likely evolved independently

  • Fungal NAD(P)H dehydrogenases may represent targets for selective inhibition to control pathogens

  • Structural differences between plant and fungal proteins could be exploited for antifungal development

  • Co-evolution studies might reveal adaptations in pathogen electron transport systems to overcome plant defenses

Research has identified multiple Calonectria species affecting Eucalyptus plantations, with C. pseudoreteaudii isolated from both diseased leaves and soils . Understanding the electron transport systems in both host and pathogen could provide novel approaches to disease management in plantation forestry.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.