Recombinant Eucalyptus globulus subsp. globulus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Structure and Functional Role of CP47

CP47, encoded by the psbB gene, is a chlorophyll-binding antenna protein integral to PSII. It facilitates energy transfer to the PSII reaction center and stabilizes the oxygen-evolving complex (OEC) by interacting with extrinsic OEC subunits . Key structural features include:

  • Molecular Weight: 56.0 kDa (predicted from nucleotide sequence) .

  • Domains: Six transmembrane helices with a large extrinsic loop (Loop E) critical for OEC assembly .

  • Pigment Binding: Binds 16 chlorophyll a molecules and 4 β-carotenes in cyanobacterial homologs .

Mutagenesis studies in Synechocystis sp. PCC 6803 demonstrated that mutations in Loop E (e.g., R448G) impair PSII activity and increase photoinactivation rates .

Recombinant Expression and Purification

The E. globulus CP47 apoprotein is produced recombinantly for research applications. Key expression systems and product specifications include:

Table 2: Key Research Insights

Study FocusFindingsSource
PSII AssemblyCP47 recruitment requires prior D1-D2 heterodimer assembly.
Mutagenesis ImpactR448G mutation reduces PSII quantum yield by 45% in cyanobacteria.
Antenna FunctionBinds chlorophylls in a preassembled state before PSII integration.

Applications:

  • Antibody Production: Used as an antigen in ELISA kits for plant biology research .

  • Photosynthesis Studies: Enables in vitro reconstitution of PSII complexes .

Challenges in Production

  • Post-Translational Modifications: Eukaryotic hosts (e.g., insect cells) are often required for functional folding, increasing cost and complexity .

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; working aliquots must be stored at 4°C for ≤1 week .

Future Directions

  • Structural Biology: High-resolution cryo-EM studies to map chlorophyll-binding sites.

  • Biotechnological Engineering: Leveraging Agrobacterium-mediated transformation (e.g., as in E. globulus salt-tolerance studies ) to optimize recombinant expression in plant hosts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us and we will prioritize its inclusion in the development process.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGAGLAKNQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTRRQVV
Uniprot No.

Target Background

Function
Photosystem II CP47 chlorophyll apoprotein (psbB) is a key component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a crucial role in catalyzing the primary light-induced photochemical reactions of PSII. PSII acts as a light-driven water:plastoquinone oxidoreductase, harnessing light energy to extract electrons from water, generating oxygen and a proton gradient that is ultimately used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CP47 from Eucalyptus globulus and how does it compare to other species?

CP47 is a transmembrane protein with six membrane-spanning helical domains that bind chlorophyll molecules. The protein serves as a core antenna complex in Photosystem II, capturing light energy and transferring it to the reaction center. Based on structural homology studies, the CP47 from Eucalyptus globulus likely shares significant structural similarity with other plant species .

The CP47 protein contains approximately 14-16 chlorophyll binding sites, with histidine residues serving as axial ligands for chlorophyll binding. Research indicates that of the 14 densities assigned to chlorophyll in structural models, five have their magnesium ions within 4 Å of the imidazole nitrogens of histidine residues, allowing direct ligation . The remaining chlorophyll molecules have their potential binding histidines at distances of 4-8 Å, suggesting alternative binding mechanisms or the involvement of other amino acid residues .

How does the chlorophyll arrangement in CP47 affect energy transfer efficiency?

The arrangement of chlorophyll molecules within CP47 creates an energy transfer network with specific spectroscopic properties. Recent multiscale quantum mechanics/molecular mechanics (QM/MM) approaches have revealed that the ranking of site energies and identity of the most red-shifted chlorophylls (B3, followed by B1) differs from previous hypotheses . This arrangement creates an energy funnel that directs excitation energy toward the reaction center.

The excitation energies of chlorophyll molecules in CP47 are significantly influenced by the protein environment through electrostatic effects. Time-dependent density functional theory calculations have quantified these effects, providing a high-level quantum chemical excitation profile of CP47 .

ChlorophyllRelative Energy (nm)Electrostatic Shift (cm⁻¹)Energy Transfer Role
B3Most red-shifted-120 to -150Terminal energy acceptor
B1Second red-shifted-80 to -110Secondary energy acceptor
B5, B6Intermediate-40 to -70Energy conduits
B11, B12Blue-shifted+30 to +60Initial energy donors

What is the gene structure of psbB in the Eucalyptus globulus chloroplast genome?

The psbB gene is located in the large single copy (LSC) region of the Eucalyptus globulus chloroplast genome, which has a total size of 160,286 bp. The chloroplast genome contains 128 genes, including genes for 30 transfer RNAs, 4 ribosomal RNAs, and 78 proteins . The gene order is similar to that found in other plant species such as Nicotiana, with an inverted repeat (IR) of 26,393 bp separated by a large single copy region of 89,012 bp and a small single copy region of 18,488 bp .

What expression systems are most suitable for producing recombinant CP47 from Eucalyptus globulus?

While there is no specific literature on the expression of recombinant CP47 from Eucalyptus globulus, recent advances in expression systems provide viable approaches. The Komagataella phaffii (Pichia pastoris) expression system with glutamate-inducible promoters offers advantages for recombinant membrane protein production .

A promising strategy employs the phosphoenolpyruvate carboxykinase promoter (PPEPCK) with monosodium glutamate (MSG) as an inducer, combined with ethanol as a carbon source. This system has demonstrated protein yields comparable to or exceeding those from the traditional methanol-inducible alcohol oxidase 1 promoter (PAOX1) .

Expression SystemInducerAdvantagesPotential Yield
K. phaffii PPEPCKMSG/ethanolNon-toxic inducers, no toxic metabolites100-120 A600 units/ml after 72h
K. phaffii PAOX1MethanolWell-established, high expressionReference standard
E. coliIPTGRapid growth, simple mediaLower for membrane proteins
Plant-basedLight/hormonesNative folding environmentLower yield, longer production time

How can I optimize MSG/ethanol mixed feeding for maximizing recombinant CP47 expression?

For optimal expression using the MSG/ethanol system, implement the following protocol:

  • Prepare induction medium containing 1.0% yeast extract, 2.0% peptone, 0.17% yeast nitrogen base with ammonium sulfate, 100 mM potassium phosphate (pH 6.0), 0.4 mg/L biotin, 2.0% MSG, and 2% ethanol .

  • Consider substituting ammonium sulfate with 0.5% urea as an optional modification .

  • Replenish the carbon source every 24 hours during a 72-hour induction period to maintain protein production .

  • Monitor culture density, aiming for 100-120 A600 units/ml after 72 hours of induction in shake flask cultivations .

  • For membrane proteins like CP47, supplement with specific lipids or detergents to aid in proper folding and stability during expression.

What are the challenges in expressing a chlorophyll-binding protein like CP47 in heterologous systems?

Expressing chlorophyll-binding proteins presents unique challenges:

  • Chlorophyll availability: Most heterologous hosts lack the chlorophyll biosynthetic pathway, requiring either co-expression of chlorophyll biosynthesis genes or reconstitution with purified chlorophyll post-expression.

  • Membrane integration: CP47 contains six transmembrane helices that must be properly inserted into membranes, requiring specialized expression hosts with appropriate membrane insertion machinery.

  • Protein folding: The complex structure of CP47, with its multiple membrane-spanning domains and chlorophyll binding sites, requires careful optimization of expression conditions to avoid misfolding.

  • Potential toxicity: Accumulation of improperly folded CP47 or free chlorophyll molecules can lead to phototoxicity and oxidative stress in expression hosts.

What is the most effective purification strategy for recombinant CP47 from Eucalyptus globulus?

A multi-step purification strategy is recommended:

  • Membrane isolation: Following cell lysis, isolate membrane fractions through differential centrifugation.

  • Detergent solubilization: Solubilize membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to extract membrane proteins while maintaining native structure.

  • Immobilized metal affinity chromatography (IMAC): If your recombinant construct includes a polyhistidine tag, use IMAC for initial purification.

  • Ion exchange chromatography: Apply the partially purified protein to an anion exchange column, exploiting CP47's negative charge at physiological pH.

  • Size exclusion chromatography: Perform a final purification step to isolate properly folded protein and remove aggregates.

Throughout purification, maintain conditions that preserve chlorophyll binding by working in dim light, low temperatures (4°C), and including stabilizing agents such as glycerol and antioxidants.

What spectroscopic methods are most effective for analyzing the chlorophyll binding properties of purified CP47?

Several complementary spectroscopic techniques should be employed:

  • Absorption spectroscopy: Measure wavelength-dependent absorption to identify the characteristic peaks of protein-bound chlorophyll molecules. The Qy absorption band (~675-680 nm) provides information about chlorophyll environment and protein-pigment interactions .

  • Circular dichroism (CD): Use CD spectroscopy to analyze both protein secondary structure (far-UV region) and pigment-protein interactions (visible region).

  • Fluorescence spectroscopy: Analyze emission characteristics of bound chlorophylls to assess protein folding quality and energy transfer properties.

  • Time-resolved spectroscopy: Employ ultrafast spectroscopic techniques to measure excitation energy transfer dynamics within the CP47 complex.

  • Resonance Raman spectroscopy: Analyze vibrational modes of chlorophyll molecules to gain insights into their binding environment.

How can I use computational methods to model the structure of Eucalyptus globulus CP47?

Develop accurate structural models through a multi-faceted computational approach:

  • Homology modeling: Construct an initial model using crystal structures of cyanobacterial PSII (PDB IDs: 3WU2, 4UB6) as templates. The sequence identity between Eucalyptus and cyanobacterial CP47 is typically around 70-80%, enabling reliable modeling .

  • Molecular dynamics simulations: Refine models through simulations in explicit membrane environments to assess structural stability and conformational dynamics.

  • QM/MM methodologies: Apply quantum mechanics/molecular mechanics approaches to accurately model chlorophyll binding sites and excitation energies .

  • Electrostatic calculations: Quantify the effect of the protein environment on chlorophyll site energies using Poisson-Boltzmann solvers or similar methods .

  • Validation: Validate computational models through comparison with experimental spectroscopic data on chlorophyll absorption and energy transfer characteristics.

What are the key considerations for applying electron microscopy to study recombinant CP47 structure?

When applying electron microscopy to CP47:

  • Sample preparation: Optimize detergent concentration to maintain protein structure while minimizing background. Consider using amphipols or nanodiscs as alternatives to detergents.

  • Negative staining vs. cryo-EM: While negative staining provides rapid assessment of sample quality, cryo-electron microscopy is essential for high-resolution structural determination.

  • Data processing: Apply specialized image processing algorithms to account for the relatively small size of isolated CP47 (~56 kDa) and its pseudo-symmetrical arrangement of transmembrane helices.

  • Resolution considerations: Aim for resolutions better than 8 Å to accurately position chlorophyll molecules and identify potential ligands, as early models of CP47 at 8 Å resolution proved insufficient for precise chlorophyll positioning .

  • Validation: Correlate structural features with spectroscopic data to confirm the biological relevance of the observed structures.

How can I assess energy transfer efficiency in recombinant CP47 protein?

Energy transfer efficiency can be assessed through:

  • Fluorescence lifetime measurements: Use time-correlated single photon counting (TCSPC) to measure chlorophyll fluorescence lifetimes, which reflect energy transfer processes.

  • Excitation-emission matrices: Record fluorescence emission at different excitation wavelengths to map energy transfer pathways.

  • Transient absorption spectroscopy: Apply ultrafast pump-probe techniques to directly observe energy transfer dynamics on picosecond timescales.

  • Fluorescence quantum yield determination: Compare the quantum yield of isolated CP47 with that of free chlorophyll to quantify energy transfer efficiency.

  • Temperature-dependent studies: Analyze how energy transfer changes with temperature to extract thermodynamic parameters and distinguish between different transfer mechanisms.

What methods can be used to study the interaction between recombinant CP47 and other Photosystem II components?

To study protein-protein interactions:

  • Co-immunoprecipitation: Use antibodies against CP47 or interaction partners to isolate protein complexes.

  • Surface plasmon resonance: Measure binding kinetics and affinities between immobilized CP47 and PSII components in solution.

  • Förster resonance energy transfer (FRET): Label CP47 and potential interaction partners with fluorescent tags to detect proximity-dependent energy transfer.

  • Cross-linking mass spectrometry: Apply chemical cross-linkers followed by proteolytic digestion and mass spectrometry to identify interaction interfaces.

  • Reconstitution experiments: Attempt to reconstitute partial PSII complexes using purified recombinant components and assess functionality through spectroscopic methods.

How can I address issues with protein stability during recombinant CP47 purification?

To improve protein stability:

  • Buffer optimization: Screen different buffer compositions, paying particular attention to pH (typically 6.0-7.5), salt concentration (100-500 mM), and the inclusion of stabilizing agents like glycerol (10-20%).

  • Detergent screening: Test multiple detergents beyond DDM, including digitonin, GDN, or LMNG, which often provide better stability for photosynthetic membrane proteins.

  • Lipid supplementation: Add specific lipids such as DGDG or SQDG, which are natural components of thylakoid membranes, to stabilize the protein structure.

  • Antioxidant addition: Include compounds like ascorbate, tocopherol, or TCEP to minimize oxidative damage during purification.

  • Light and temperature control: Conduct all manipulations in dim green light and at 4°C to prevent chlorophyll degradation and photodamage.

What approaches can resolve problems with chlorophyll dissociation from recombinant CP47?

To maintain chlorophyll association:

  • Reconstitution protocols: Develop methods to reconstitute purified apoprotein with chlorophyll a extracted from natural sources or synthesized chemically.

  • Site-directed mutagenesis: Identify and modify residues outside the critical chlorophyll-binding sites to enhance protein stability without affecting pigment binding.

  • Chemical cross-linking: Apply mild cross-linking agents to stabilize protein structure after ensuring proper chlorophyll binding.

  • Alternative expression strategies: Consider cell-free expression systems supplemented with chlorophyll and necessary lipids for co-translational incorporation.

  • Storage optimization: Develop specialized storage conditions, potentially including flash-freezing in liquid nitrogen with cryoprotectants to maintain the chlorophyll-protein complex integrity long-term.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.