Recombinant Eucalyptus globulus subsp. globulus Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

PsbZ (Photosystem II reaction center protein Z) facilitates PSII assembly and stability:

  • Structural Integration: PsbZ anchors light-harvesting complexes to the PSII core, optimizing energy transfer efficiency .

  • Chlorophyll Association: Mutations in psbZ homologs disrupt chlorophyll delivery, highlighting its role in pigment-protein coordination .

  • Oxidative Stress Response: PsbZ expression correlates with PSII repair under high-light stress, as photodamaged D1 requires rapid replacement .

Expression and Purification

  • Vector System: Optimized for soluble expression in E. coli, enabling high-yield extraction .

  • Reconstitution: Lyophilized powder is reconstituted in deionized water (0.1–1.0 mg/mL) with glycerol for long-term stability .

Research Applications

ApplicationUse CaseCitation
Antibody DevelopmentEpitope mapping for PSII studies
Mutagenesis StudiesAssessing PSII assembly defects
Stress ResponseAnalyzing photodamage repair mechanisms

Regulatory Mechanisms

PsbA/Z expression is tightly regulated through:

  • Transcriptional Control: Light-responsive promoters and sigma factors modulate psbA transcription in cyanobacteria and plants .

  • Translational Activation: Nuclear-encoded factors like HCF173 and LPE1 bind psbA mRNA 5′ UTRs to enhance ribosome recruitment under light .

  • Post-Translational Modifications: Redox-sensitive disulfide isomerases (e.g., RB60) regulate D1 synthesis in Chlamydomonas .

Evolutionary and Comparative Insights

  • Cyanobacteria vs. Plants: Cyanobacterial psbA genes exhibit isoform switching (D1:1 to D1:2) under high light, whereas plants rely on translational regulation .

  • Algal Adaptations: Chlamydomonas psbA translation bypasses chlorophyll binding dependencies observed in land plants, suggesting divergent repair strategies .

Challenges and Future Directions

  • Heterologous Expression: While E. coli systems yield functional protein, chloroplast-specific post-translational modifications (e.g., lipidation) may require plant-based platforms .

  • Structural Resolution: Cryo-EM studies of recombinant psbZ could clarify its interaction with D1 during PSII repair .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments default to blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors such as storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Eucalyptus globulus subsp. globulus (Tasmanian blue gum)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What are the key methodological considerations for expressing recombinant Eucalyptus globulus psbA protein in heterologous systems?

Expressing recombinant Eucalyptus globulus psbA protein in heterologous systems presents several methodological challenges that require careful consideration:

Expression System Selection:

  • Bacterial systems (E. coli): While commonly used for protein expression, they may struggle with proper folding of membrane proteins like D1. E. coli has been used successfully for expressing psbA from other species, but optimization is necessary .

  • Algal systems: Algal chloroplasts, particularly Chlamydomonas reinhardtii, offer advantages for photosynthetic protein expression. The psbA promoter in C. reinhardtii can drive high-level expression (up to 20.9% of total cell protein) when used in a psbA-deficient strain .

  • Plant systems: These can provide appropriate post-translational modifications but typically yield lower expression levels.

Promoter and Regulatory Elements:

  • For bacterial expression, strong, inducible promoters like T7 are typically used.

  • In algal systems, the psbA promoter and untranslated regions (UTRs) have shown the highest expression levels, particularly in psbA-deficient strains. Comparative studies have shown that the psbA promoter outperforms other chloroplast promoters like atpA and psbD .

  • The choice between constitutive and inducible promoters depends on whether the protein is toxic to the host.

Codon Optimization:

  • The chloroplast genome has distinct codon usage compared to nuclear genomes. Codon optimization of the psbA sequence for the chosen expression system is crucial for efficient translation.

Solubility Enhancement:

  • As a membrane protein, D1 is inherently hydrophobic. Fusion tags (such as His-tags) can be added to enhance solubility and facilitate purification.

  • Some researchers have reported success using fusion partners like serum amyloid protein (M-SAA) to improve expression and solubility. This approach has achieved expression levels of approximately 10% of total soluble protein .

Recovery of Functional Protein:

  • Proper folding and membrane insertion are critical for D1 function. Inclusion of appropriate detergents or lipids during extraction may be necessary to maintain protein structure.

  • Purification methods must be gentle to preserve protein activity. Affinity chromatography using added tags (like His-tag) can facilitate this process.

Verification of Functionality:

  • Functional assays specific to D1 should be employed to verify that the recombinant protein retains its electron transport capabilities.

  • Methods such as flash-induced fluorescence decay or thermoluminescence measurements can assess proper electron transfer functions .

  • How can researchers effectively analyze psbA gene expression in response to varying light conditions in Eucalyptus globulus?

Analyzing psbA gene expression in response to varying light conditions in Eucalyptus globulus requires a multi-faceted approach combining molecular, biochemical, and physiological techniques:

Experimental Design:

  • Implement a controlled environment with precise light intensity, quality (wavelength), and duration parameters.

  • Include appropriate time points to capture both rapid and long-term responses (minutes to days).

  • Establish a gradient of light intensities, from low to high, to determine thresholds for response.

  • Consider using light filters to test responses to specific wavelengths.

Transcript Analysis:

  • Quantitative RT-PCR: Design primers specific to E. globulus psbA to quantify transcript levels accurately.

  • RNA-Seq: For a global view of transcriptional changes, including psbA and other photosynthesis-related genes.

  • Northern blotting: To assess transcript stability and processing.

  • Run-on transcription assays: To distinguish between changes in transcription initiation and mRNA stability.

Translational Analysis:

  • Polysome profiling: Light stimulates the recruitment of ribosomes specifically to psbA mRNA. This technique can be used to assess translational efficiency under different light conditions .

  • Western blotting: To monitor protein accumulation using antibodies specific to D1 protein.

  • Pulse-chase labeling: To measure the rate of D1 protein synthesis and turnover under different light regimes.

Protein Function Assessment:

  • Chlorophyll fluorescence: To measure PSII efficiency (Fv/Fm) as an indicator of D1 function.

  • Thermoluminescence and delayed fluorescence measurements: To detect shifts in the redox potential of electron acceptors bound to D1, as shown in studies with PsbA1 and PsbA3 in cyanobacteria .

  • P700 absorbance changes: To assess electron flow through the entire photosynthetic electron transport chain.

Integration with Physiological Measurements:

  • Gas exchange: To correlate gene expression with photosynthetic CO2 fixation rates.

  • Reactive oxygen species (ROS) detection: As high light induces photooxidative stress and D1 damage.

  • Antioxidant enzyme activities: To understand the relationship between photoprotection and psbA expression.

Data Analysis:

  • Time-course analysis: To determine the temporal sequence of events.

  • Dose-response curves: To establish the relationship between light intensity and gene expression.

  • Statistical validation: Using appropriate models for repeated measures and multiple comparisons.

  • Integration of multi-omics data: To place psbA regulation in the broader context of the photosynthetic apparatus.

  • What techniques can be employed to study the protein-protein interactions of psbA-encoded D1 protein in the thylakoid membrane?

Studying protein-protein interactions of the psbA-encoded D1 protein in the thylakoid membrane requires specialized techniques due to its membrane-embedded nature. Here are key methodological approaches:

In Vitro Methods:

  • Co-immunoprecipitation (Co-IP): Using antibodies specific to D1 protein to pull down interaction partners, followed by mass spectrometry identification. This requires efficient membrane solubilization while preserving protein-protein interactions.

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE): This technique separates intact protein complexes and can be combined with a second-dimension SDS-PAGE to identify individual components within each complex.

  • Cross-linking Mass Spectrometry: Chemical cross-linkers can capture transient or weak interactions before solubilization, and mass spectrometry can identify the cross-linked residues, providing spatial information about the interaction interfaces.

  • Surface Plasmon Resonance (SPR): For quantifying binding kinetics between D1 and potential interaction partners, though this requires at least one purified component.

In Vivo Methods:

  • Bimolecular Fluorescence Complementation (BiFC): By fusing complementary fragments of a fluorescent protein to D1 and a potential interaction partner, interaction brings the fragments together to reconstitute fluorescence.

  • Förster Resonance Energy Transfer (FRET): Using fluorescently tagged proteins to detect proximity-based energy transfer, indicating interaction.

  • Split Ubiquitin System: A yeast-based method adapted for membrane proteins, where reconstitution of split ubiquitin upon protein interaction leads to reporter gene activation.

Structural Methods:

  • Cryo-Electron Microscopy: This has revolutionized membrane protein structure determination and can reveal D1's interaction network within the PSII complex at near-atomic resolution.

  • X-ray Crystallography: Though challenging for membrane proteins, it has been used successfully for photosynthetic complexes, including PSII.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To identify regions of D1 that become protected or exposed upon binding to partners.

Genetic and Functional Methods:

  • Mutational Analysis: Systematic mutation of D1 residues to identify those critical for interaction with various partners.

  • Suppressor Screening: Identifying mutations in other proteins that can compensate for D1 mutations, suggesting functional interaction.

  • Complementation Studies: As demonstrated with Arabidopsis PsbO1 mutants, functional complementation assays can reveal whether modified D1 proteins maintain normal interactions within the PSII complex .

Computational Methods:

  • Molecular Docking: To predict potential interaction interfaces between D1 and other proteins.

  • Molecular Dynamics Simulations: To examine the dynamic behavior of D1 and its partners within the membrane environment.

  • Coevolution Analysis: Identifying correlated mutations across protein families that may indicate interaction interfaces.

  • How do the structural characteristics of Eucalyptus globulus psbA compare with those of other plant species?

Comparing the structural characteristics of Eucalyptus globulus psbA with those of other plant species requires analysis at multiple levels:

Sequence Comparison:

  • Primary Structure: The amino acid sequence of E. globulus psbA (D1 protein) shares high homology with other plants, reflecting the conserved function of this critical photosynthetic protein. Based on the sequence provided in research data , we can compare with other species like Solanum bulbocastanum , which shows remarkably high conservation.

Sequence Homology Table:

SpeciesPercent Identity with E. globulus psbANotable Differences
Solanum bulbocastanum~98%Minor differences in variable regions
Arabidopsis thaliana~95%Variations in transit peptide region
Chlamydomonas reinhardtii~87%More divergence in stromal-exposed loops
Thermosynechococcus elongatus~85%Differences in quinone binding pocket

Functional Domains:

  • Transmembrane Helices: E. globulus D1 contains five transmembrane helices that are highly conserved across species, as these form the core structural elements that position cofactors precisely for efficient electron transfer.

  • QB Binding Pocket: This site, which binds plastoquinone, shows subtle species-specific differences that can affect herbicide binding and electron transfer kinetics.

  • D1-D2 Interface: The regions that interact with the D2 protein to form the reaction center are among the most conserved.

Phylogenetic Implications:

  • According to research data, the trnH-psbA spacer region shows significant variability (4.41%) even among closely related Eucalyptus species, making it useful for taxonomic discrimination . This contrasts with the high conservation of the coding region itself.

  • The evolutionary rate of psbA is slower than many nuclear genes but faster than some other chloroplast genes, positioning it as moderately useful for phylogenetic studies at the genus level.

Expression and Regulation:

  • Regulatory Regions: While the coding sequence is highly conserved, the promoter and untranslated regions (UTRs) show more variation across species, leading to differences in expression patterns.

  • Light-regulated translation of psbA mRNA is a common feature across photosynthetic organisms, but the specific regulatory proteins involved may differ between taxonomic groups .

Functional Differences:

  • Different copies of psbA in the same organism (e.g., in Thermosynechococcus elongatus) can show functional specialization, with some variants better adapted to high light conditions . It remains to be determined whether E. globulus shows similar functional adaptation of its psbA product compared to other Eucalyptus species.

  • What are the current challenges in studying the repair cycle of D1 protein in Eucalyptus species?

Studying the repair cycle of D1 protein (encoded by psbA) in Eucalyptus species presents several significant challenges:

Technical Challenges:

  • Genetic Manipulation: Unlike model plants such as Arabidopsis, Eucalyptus species are more difficult to transform, limiting the use of genetic approaches to study D1 repair mechanisms.

  • Chloroplast Isolation: The presence of high levels of secondary metabolites in Eucalyptus leaves, including essential oils with antimicrobial and anti-inflammatory properties , complicates the isolation of pure, functional chloroplasts for biochemical studies.

  • Protein Turnover Measurement: Quantifying the rapid turnover of D1 protein requires pulse-chase labeling techniques that are challenging to implement in woody species with thick, recalcitrant tissues.

Biological Complexity:

  • Species Diversity: The Eucalyptus genus contains over 700 species with varying photosynthetic adaptations. Even closely related species show significant genetic variation , making it difficult to generalize findings across the genus.

  • Developmental Stages: Eucalyptus species exhibit heterophylly (different leaf forms at different developmental stages), which may involve distinct D1 repair mechanisms or rates.

  • Environmental Adaptation: Eucalyptus species are adapted to diverse ecological niches, from wet temperate forests to arid woodlands, potentially resulting in species-specific adaptations in PSII repair mechanisms.

Methodological Challenges:

  • Light Response Studies: Controlled environment studies with trees are logistically challenging due to their size, making it difficult to conduct detailed light response experiments for D1 repair kinetics.

  • Time-Course Analysis: The slow growth rate of eucalypts compared to herbaceous model plants extends the timeline for experiments investigating acclimation responses in D1 repair.

  • Proteomics Limitations: The identification of species-specific auxiliary proteins involved in Eucalyptus D1 repair is hampered by incomplete genomic and proteomic databases for many Eucalyptus species.

Regulatory Complexity:

  • Light-Dependent Regulation: Light triggers both transcriptional and translational responses in psbA expression, but the signaling pathways may differ between Eucalyptus and model organisms .

  • Retrograde Signaling: The communication between chloroplasts and the nucleus that coordinates D1 repair with other cellular processes remains poorly understood in woody species like Eucalyptus.

  • Multiple Regulatory Layers: The involvement of factors like LPE1 in binding to psbA mRNA in a light-dependent manner adds complexity that may differ between species .

Integration with Stress Responses:

  • Adaptations to High Light: Eucalyptus species native to Australia often experience high light intensities, potentially evolving specialized D1 repair mechanisms that differ from those in model plants.

  • Interaction with Secondary Metabolism: The relationship between D1 repair and the production of protective secondary compounds (such as the essential oils with significant antimicrobial activity ) presents an additional layer of complexity.

  • Combined Stress Responses: Understanding how D1 repair responds to combined stresses (e.g., high light with drought, which is common in Eucalyptus habitats) requires complex experimental designs.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.