Recombinant Eulemur fulvus fulvus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the solution for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Eulemur fulvus fulvus (Brown lemur)
Target Names
Target Protein Sequence
MPAQGSQRGLLGAVNFTPTATPHLRPAANQTGPQCLEVSVPDGLFLCLGLVSLVENTLVV AAIAKNRNLHSPMYCFICCLALSDLLVSVSNLLETAVLLLLEVGALAAQATVVQQLGNVI DVLICSSMVSSLCSLGAIAMDRYISIFYALRYHSIVTLARARRAIAAVWAASILSSTLFI TYYDRTAALLCLVVFFLAMLVLMALLYVHMLIQACQHAQAIARLHKRQHPVQQGWGLKGA ATLTILLGVFFLCWGPFFLHLTLIAVCPQHPTCSCIFKNFRLFLALIICNTIVDPLIYAF RSQELRRTLKEVLLFSW
Uniprot No.

Target Background

Function
This receptor binds to melanocyte-stimulating hormone (MSH, alpha, beta, and gamma) and adrenocorticotropic hormone (ACTH). Its activity is mediated by G proteins which activate adenylate cyclase. It plays a role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Eulemur fulvus fulvus MC1R?

The Melanocyte-stimulating hormone receptor (MC1R) from Eulemur fulvus fulvus is a G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) family of peptide receptors within the melanocortin receptor subfamily. The receptor consists of 317 amino acids organized into the characteristic seven-transmembrane domain (7TM) structure typical of GPCRs. The protein includes an extracellular N-terminus, seven transmembrane helices (TM1-TM7), three extracellular loops (ECL1-3), three intracellular loops (ICL1-3), and an intracellular C-terminus with a potential eighth helix (H8). This structural organization is critical for its function in melanocortin signaling pathways .

How does the amino acid sequence of Eulemur fulvus fulvus MC1R compare to other species?

The Eulemur fulvus fulvus MC1R protein sequence demonstrates the evolutionary conservation typical of functionally important receptors while exhibiting species-specific variations. While the search results don't provide direct sequence comparisons, the receptor maintains the highly conserved DRY motif (Asp-Arg-Tyr) in the third transmembrane domain (positions 141-143), which is crucial for G-protein coupling and signal transduction in Class A GPCRs. The transmembrane domains show higher conservation across species compared to the loop regions, reflecting evolutionary pressure to maintain the core functional structure while allowing species adaptation through variations in the more flexible regions .

What are the key functional domains in Eulemur fulvus fulvus MC1R?

The Eulemur fulvus fulvus MC1R contains several key functional domains essential for its biological activity. The DRY motif (positions 141-143) in TM3 is critical for G-protein coupling and activation. The extracellular loops, particularly ECL2, contribute to ligand binding specificity and selectivity. The ICL3 (intracellular loop 3) between TM5 and TM6 plays a crucial role in G-protein interaction and downstream signaling cascade initiation. The C-terminal domain contains potential phosphorylation sites that may regulate receptor desensitization and internalization. Understanding these domains is essential for designing functional studies and for targeted mutagenesis experiments examining structure-function relationships .

What expression systems are most effective for recombinant Eulemur fulvus fulvus MC1R production?

For recombinant expression of Eulemur fulvus fulvus MC1R, researchers should consider multiple expression systems based on experimental objectives. For functional studies requiring proper folding and post-translational modifications, mammalian expression systems (HEK293, CHO cells) are recommended despite their lower yields. These systems provide the appropriate cellular machinery for GPCR processing and trafficking to the plasma membrane. Insect cell systems (Sf9, High Five) using baculovirus vectors offer a compromise between yield and proper folding. For structural studies requiring larger protein quantities, yeast systems (Pichia pastoris) may be considered, though optimization of growth conditions and codon usage is necessary to overcome potential expression challenges typical for GPCRs.

What are the critical considerations for designing an MC1R expression construct?

When designing an expression construct for Eulemur fulvus fulvus MC1R, researchers must address several critical factors. First, codon optimization for the expression host is essential to enhance translation efficiency. Second, incorporating purification tags (such as His6, FLAG, or HA) at either the N- or C-terminus facilitates protein detection and purification, though C-terminal tags are generally preferred to avoid interference with the signal peptide processing. Third, inclusion of cleavable tags using protease recognition sites (TEV, PreScission) enables tag removal for structural or functional studies. Additionally, consideration should be given to incorporating stabilizing mutations or fusion partners (such as T4 lysozyme or thermostabilized proteins) to enhance expression and stability, particularly for structural biology applications.

What purification strategy yields the highest purity of functional recombinant MC1R?

A multi-step purification strategy is recommended to achieve high-purity functional MC1R from Eulemur fulvus fulvus. Begin with detergent solubilization of membrane fractions using mild detergents (DDM, LMNG, or GDN) that maintain receptor functionality. Proceed with immobilized metal affinity chromatography (IMAC) for initial purification if a His-tag was incorporated into the construct. Further purification via size exclusion chromatography (SEC) separates monomeric receptor from aggregates and contaminants. For highest purity, consider an additional step using ligand affinity chromatography with immobilized MC1R-specific ligands. Throughout purification, maintain receptor stability by including cholesterol hemisuccinate (CHS) in buffers and considering the use of lipid nanodiscs or reconstitution into proteoliposomes for functional studies. Verification of purity using SDS-PAGE, Western blot, and mass spectrometry ensures preparation quality for downstream applications.

What methods are most effective for structural characterization of recombinant Eulemur fulvus fulvus MC1R?

Structural characterization of recombinant Eulemur fulvus fulvus MC1R requires a multi-method approach. Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for GPCR structure determination, requiring less protein than X-ray crystallography while potentially capturing different conformational states. X-ray crystallography, despite its challenges, provides high-resolution data when successful, often requiring receptor engineering to enhance crystallizability. Nuclear Magnetic Resonance (NMR) spectroscopy offers insights into dynamic properties and ligand interactions, particularly useful for studying specific domains or peptide interactions. Complementary methods include circular dichroism (CD) spectroscopy for secondary structure assessment, hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics, and molecular dynamics simulations to model structural behavior. Integration of multiple techniques provides the most comprehensive structural understanding of this complex membrane protein.

What are the key challenges in obtaining high-resolution structural data for Eulemur fulvus fulvus MC1R?

Obtaining high-resolution structural data for Eulemur fulvus fulvus MC1R presents several significant challenges inherent to GPCR structural biology. The primary difficulties include: (1) Protein instability outside the native membrane environment, requiring careful optimization of detergents, lipids, and stabilizing agents; (2) Conformational heterogeneity, as MC1R exists in multiple states (inactive, active, intermediate), necessitating strategies to lock the receptor in specific conformations using appropriate ligands or antibodies; (3) Low expression yields typical of GPCRs, requiring optimization of expression systems and conditions; (4) Crystallization challenges for X-ray crystallography, often requiring receptor engineering such as loop replacements or fusion proteins; and (5) Sample preparation hurdles for cryo-EM, including issues with preferred orientation in vitreous ice. Researchers must systematically address these challenges through receptor engineering, ligand selection, and optimization of experimental conditions to achieve structural insights into this lemur MC1R.

What signaling pathways does Eulemur fulvus fulvus MC1R primarily activate?

The Melanocyte-stimulating hormone receptor (MC1R) from Eulemur fulvus fulvus, like other melanocortin receptors, primarily couples to the Gαs protein signaling pathway. This activation triggers adenylyl cyclase, leading to increased intracellular cAMP production. The elevated cAMP subsequently activates protein kinase A (PKA), which phosphorylates the cAMP response element-binding protein (CREB) and other downstream effectors. While the Gαs pathway represents the canonical signaling route, MC1R may also engage alternative pathways including mitogen-activated protein kinase (MAPK) cascades and potentially β-arrestin-mediated signaling. The extent and significance of these non-canonical pathways in Eulemur fulvus fulvus MC1R signaling would require specific investigation, as they may contribute to species-specific functional adaptations in melanin regulation and other physiological processes.

What functional assays are most suitable for characterizing recombinant Eulemur fulvus fulvus MC1R activity?

For comprehensive functional characterization of recombinant Eulemur fulvus fulvus MC1R, researchers should implement multiple complementary assays. cAMP accumulation assays using either radioactive (³²P-cAMP) or non-radioactive (ELISA, HTRF, GloSensor) detection methods provide direct measurement of the primary signaling pathway. Calcium mobilization assays can be employed when using chimeric G proteins or in cells co-expressing promiscuous G proteins. Receptor internalization assays using fluorescently-tagged receptors enable monitoring of receptor trafficking dynamics. More advanced approaches include bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET) biosensors to measure real-time conformational changes and protein-protein interactions. β-arrestin recruitment assays (PathHunter, Tango) can determine bias in signaling pathways. Selection of appropriate assays depends on specific research questions, with consideration given to temporal resolution, sensitivity, and throughput requirements.

How do melanocortin ligands interact with the Eulemur fulvus fulvus MC1R binding pocket?

The interaction between melanocortin ligands and the Eulemur fulvus fulvus MC1R binding pocket likely involves key residues in the transmembrane domains and extracellular loops. Based on studies of melanocortin receptors across species, the binding pocket is formed primarily by residues from TM2, TM3, TM4, TM5, TM6, and TM7, with ECL2 contributing to ligand selectivity. The core binding motif for melanocortin peptides (His-Phe-Arg-Trp) interacts with specific receptor residues, including those in the Eulemur fulvus fulvus MC1R sequence positions corresponding to the transmembrane regions identified in the structural data . The acidic residues in TM3 likely interact with the basic Arg in the melanocortin core sequence, while aromatic residues in TM4, TM5, and TM6 form interactions with the Phe and Trp of the ligand. Molecular modeling and mutagenesis studies would be necessary to precisely map these interactions for the lemur receptor and identify any species-specific binding characteristics.

How has MC1R evolved across lemur species and what does this reveal about pigmentation adaptations?

The evolution of MC1R across lemur species reflects selective pressures related to pigmentation and potentially other physiological adaptations. While the search results don't provide direct evolutionary comparisons of MC1R across lemurs, we can infer from the taxonomic data that the MC1R sequence may show patterns of conservation and divergence that parallel the evolutionary relationships established through mitochondrial DNA analyses. The phylogenetic analysis revealing six clades of Eulemur fulvus subspecies suggests that MC1R might show corresponding patterns of sequence variation . These variations could potentially correlate with the diverse pelage coloration patterns observed across lemur taxa. Functional variations in MC1R across lemurs would likely reflect adaptations to different ecological niches, including response to UV radiation in different habitats across Madagascar. A comprehensive comparative analysis of MC1R sequences across lemur species, particularly focused on functional domains and ligand binding regions, would provide insights into the molecular basis of lemur pigmentation diversity.

What phylogenetic insights can be gained from comparing MC1R sequences across Eulemur fulvus subspecies?

Comparing MC1R sequences across Eulemur fulvus subspecies could provide valuable phylogenetic insights that complement existing mitochondrial DNA-based analyses. Based on the mitochondrial DNA analysis showing six distinct clades—((albocollaris, collaris) (rufus (rufus (fulvus/mayottensis (albifrons/fulvus/sanfordi)))))—we might expect corresponding patterns of variation in MC1R sequences . Particularly interesting would be examination of whether the lack of genetic differentiation between E. f. albifrons and E. f. sanfordi observed in mitochondrial DNA is also reflected in MC1R sequences. Similarly, the two separate lineages of E. f. rufus identified through mitochondrial analysis might show distinctive MC1R variants. As MC1R is under selection pressure related to pigmentation, comparing synonymous versus non-synonymous substitution rates across subspecies could reveal signatures of positive selection and adaptation, potentially correlating with the distinctive coat color patterns that characterize different Eulemur fulvus subspecies.

What are the optimal conditions for ligand binding studies with recombinant Eulemur fulvus fulvus MC1R?

Optimizing ligand binding studies for recombinant Eulemur fulvus fulvus MC1R requires careful consideration of multiple experimental parameters. The binding assay buffer should maintain receptor stability while minimizing non-specific binding, typically containing 50 mM HEPES or Tris-HCl (pH 7.4), 1-5 mM MgCl₂, 1 mM CaCl₂, and 0.1% BSA. When using membrane preparations, include protease inhibitors to prevent receptor degradation. For competition binding assays, labeled ligands such as [¹²⁵I]-NDP-MSH or fluorescently-labeled analogs should be used at concentrations near their Kd values. Saturation binding experiments should utilize a range of ligand concentrations spanning at least two orders of magnitude around the expected Kd. Non-specific binding should be determined using excess (100-1000×) unlabeled ligand. Incubation conditions typically include 1-2 hours at room temperature or 37°C, though optimization may be necessary for specific ligands. Separation of bound from free ligand can be achieved through filtration (for membrane preparations) or scintillation proximity assays (for purified receptors). Detailed analysis using nonlinear regression with appropriate binding models will provide accurate affinity and kinetic parameters.

How can site-directed mutagenesis be used to investigate key functional residues in Eulemur fulvus fulvus MC1R?

Site-directed mutagenesis represents a powerful approach for investigating key functional residues in Eulemur fulvus fulvus MC1R. Based on the receptor's sequence, researchers should first identify candidate residues for mutation, focusing on: (1) The DRY motif (positions 141-143) critical for G-protein coupling; (2) Putative ligand-binding residues in transmembrane domains, particularly those in TM3, TM5, and TM6; (3) ECL2 residues potentially involved in ligand selectivity; and (4) Potential phosphorylation sites in the C-terminus . Mutagenesis strategies should include conservative substitutions to probe specific interactions (e.g., D141E) and non-conservative changes to disrupt function (e.g., D141A). Alanine-scanning mutagenesis of transmembrane regions can systematically identify critical residues. Construct multiple mutants in parallel, including validated controls (known functional mutations). Following mutagenesis, comprehensive functional characterization should include ligand binding, G-protein activation, cAMP signaling, and receptor trafficking assays to determine how each mutation affects different aspects of receptor function. This systematic approach will establish structure-function relationships specific to the lemur MC1R.

What approaches are effective for developing species-specific antibodies against Eulemur fulvus fulvus MC1R?

Developing species-specific antibodies against Eulemur fulvus fulvus MC1R requires strategic antigen selection and validation protocols. For antigen design, researchers should analyze the receptor sequence to identify regions with high antigenicity and specificity to the lemur receptor while avoiding transmembrane domains . Ideal targets include the N-terminus (residues 1-40), extracellular loops (particularly ECL2 and ECL3), and the C-terminus (residues 310-317). These regions should be compared with MC1R sequences from other species to ensure specificity. For antibody production, synthesize peptides corresponding to these regions, conjugate to carrier proteins (KLH or BSA), and immunize rabbits or mice following standard protocols. Alternatively, express and purify recombinant fragments of extracellular domains as immunogens. Implement rigorous validation using ELISA against the immunizing peptide, Western blotting against recombinant receptor, immunoprecipitation, and immunocytochemistry with cells expressing the receptor versus controls. Cross-reactivity testing against MC1R from closely related species ensures specificity. Monoclonal antibodies offer advantages of consistency and specificity for long-term studies, while polyclonal antibodies may provide higher sensitivity for certain applications.

What are common challenges in recombinant expression of Eulemur fulvus fulvus MC1R and how can they be overcome?

Recombinant expression of Eulemur fulvus fulvus MC1R presents several common challenges that researchers should anticipate and address methodically. Low expression levels, a frequent issue with GPCRs, can be mitigated through codon optimization for the expression host, using stronger promoters, and optimizing culture conditions (temperature, induction timing, and media composition). Protein misfolding often occurs with membrane proteins; addressing this requires expression at lower temperatures (16-30°C), addition of chemical chaperones (glycerol, DMSO), or co-expression with molecular chaperones. Toxicity to host cells can be managed using tightly regulated inducible systems and toxicity-resistant host strains. Poor trafficking to the plasma membrane in mammalian systems may be improved by adding trafficking-enhancing sequences or using chimeric constructs. Receptor instability during solubilization and purification necessitates screening multiple detergents (DDM, LMNG, GDN) and including stabilizers like cholesterol hemisuccinate (CHS) in all buffers. Systematic optimization of these parameters, potentially using small-scale parallel screening approaches, will significantly improve recombinant MC1R production outcomes.

How should researchers optimize transfection conditions for maximal expression of functional MC1R in mammalian cells?

Optimizing transfection conditions for maximal expression of functional Eulemur fulvus fulvus MC1R in mammalian cells requires systematic evaluation of multiple parameters. Cell line selection is critical—HEK293 and CHO cells typically yield good GPCR expression, while HEK293S GnTI⁻ cells can provide more homogeneous glycosylation for structural studies. For transfection method, lipid-based reagents (Lipofectamine) often work well for transient expression, while calcium phosphate precipitation may be preferred for generating stable cell lines due to its gentler nature. Optimize DNA quality (endotoxin-free plasmid preparations) and quantity (typically 0.5-2 μg DNA per million cells), and evaluate the DNA:transfection reagent ratio systematically. Cell density at transfection should be 70-80% confluent for optimal balance between transfection efficiency and cell health. Consider co-transfection with chaperone proteins to enhance folding. Post-transfection, culture at reduced temperature (30-32°C) often increases functional expression by slowing trafficking and allowing more time for proper folding. Implement expression monitoring using a C-terminal fluorescent tag or an ELISA against an N-terminal epitope tag to quantitatively assess optimization efforts and establish the optimal harvest time, typically 24-72 hours post-transfection.

What quality control measures are essential when working with purified recombinant Eulemur fulvus fulvus MC1R?

Implementing rigorous quality control measures is essential when working with purified recombinant Eulemur fulvus fulvus MC1R to ensure experimental reliability and reproducibility. Purity assessment should include SDS-PAGE with Coomassie staining (>90% purity), silver staining (for detecting low-level contaminants), and Western blotting with anti-tag antibodies to confirm identity. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) should be used to assess monodispersity and determine oligomeric state. Functional integrity verification requires ligand binding assays using radiolabeled or fluorescent melanocortin peptides to confirm that Kd values fall within the expected range for functional receptor. Thermostability assessment using methods such as differential scanning fluorimetry (DSF) or circular dichroism (CD) provides critical information about sample stability under various conditions. Mass spectrometry should be employed to confirm protein identity, integrity, and post-translational modifications. For structural biology applications, negative-stain electron microscopy serves as a valuable pre-screening tool before committing samples to cryo-EM or crystallization trials. Establishing these quality control benchmarks enables meaningful comparison between different preparations and ensures that downstream experimental results accurately reflect the receptor's native properties.

What statistical approaches are most appropriate for analyzing MC1R functional data?

When analyzing functional data for Eulemur fulvus fulvus MC1R, researchers should implement appropriate statistical approaches tailored to specific experimental designs. For dose-response experiments, nonlinear regression using four-parameter logistic models should be applied to determine EC50/IC50 values, with comparison between conditions using extra sum-of-squares F-test or AICc (Akaike Information Criterion corrected). Time-course experiments should be analyzed using area under the curve (AUC) calculations or kinetic parameter determination through exponential association/dissociation models. For binding experiments, one-site or two-site binding models should be fitted using nonlinear regression to determine Kd and Bmax values. When comparing multiple conditions or mutants, one-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's) should be used for normally distributed data, or non-parametric alternatives (Kruskal-Wallis with Dunn's post-test) when normality cannot be assumed. For all analyses, researchers should report both effect sizes and p-values, with appropriate correction for multiple comparisons when necessary. Power analysis prior to experiments ensures adequate sample sizes, while bootstrapping or permutation tests provide robust analysis for smaller datasets with potentially non-normal distributions.

How should researchers interpret differences in signaling profiles between wild-type and mutant Eulemur fulvus fulvus MC1R?

Interpreting differences in signaling profiles between wild-type and mutant Eulemur fulvus fulvus MC1R requires a comprehensive analytical framework considering multiple signaling parameters. When comparing dose-response curves, researchers should analyze changes in both potency (EC50) and efficacy (Emax), as mutations can affect ligand binding affinity, G-protein coupling efficiency, or both. Rightward shifts in EC50 without Emax changes typically indicate altered binding affinity, while reduced Emax suggests impaired coupling or downstream signaling. For kinetic differences, analyze both the rate and magnitude of response, as mutations may affect the speed of conformational changes or the stability of active states. When examining pathway selectivity, calculate bias factors using operational models to quantify shifts in signaling preference (e.g., Gαs vs. β-arrestin pathways). Correlation analysis between mutation effects on different signaling parameters can reveal mechanistic insights—for example, mutations affecting both binding and signaling suggest residues with dual roles. Context-dependency is crucial; interpret results considering the specific ligand used, as different ligands may interact distinctly with mutated residues. Finally, integrate functional data with structural information (based on the known sequence and predicted structure) to develop molecular models explaining how specific mutations alter receptor function .

What approaches effectively compare MC1R sequence and functional data across different lemur species?

Effective comparison of MC1R sequence and functional data across lemur species requires integrated computational and experimental approaches. For sequence analysis, perform multiple sequence alignment of MC1R from diverse lemur species, focusing particularly on the Eulemur genus, using MUSCLE or MAFFT algorithms. Calculate conservation scores for each position and map these onto the predicted receptor structure to identify functionally constrained regions versus species-specific variations. Phylogenetic analysis using maximum likelihood or Bayesian methods can reconstruct the evolutionary history of MC1R in lemurs, with comparison to the established mitochondrial phylogeny to detect any incongruences suggesting adaptive evolution . For detecting selection pressures, calculate dN/dS ratios across the alignment, implementing site-specific models to identify positively selected residues potentially associated with pigmentation adaptations. Experimentally, comparative pharmacological profiling of recombinant MC1R from different lemur species using standardized assays allows direct functional comparison. Chimeric receptors containing domains from different species can pinpoint regions responsible for functional differences. Finally, correlation analysis between MC1R sequence variations, functional parameters, and phenotypic characteristics (coat color patterns) across lemur species can reveal structure-function-phenotype relationships, providing insights into the molecular basis of evolutionary adaptations in lemur pigmentation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.