Recombinant Eulemur mongoz NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what role does it play in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a gene encoded in the mitochondrial genome that produces a crucial subunit of Complex I in the electron transport chain. The protein is a small but essential component of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain . In Eulemur mongoz (Mongoose lemur), as in other mammals, the MT-ND4L protein consists of 98 amino acids forming a highly hydrophobic transmembrane protein with the sequence: MPSITNIILAFIITALLGMLIFRSHLMSSLLCLEGMMLSMFILSTLTILNLHFTASFMMPPILLLVFAACEAAVGLALLVTVSNTYGLDYIQNLNLLQC .

The primary function of MT-ND4L is to contribute to the proton-pumping mechanism of Complex I, which drives ATP synthesis through oxidative phosphorylation. As one of the core hydrophobic subunits, it helps form the transmembrane domain of Complex I, which is essential for proton translocation across the inner mitochondrial membrane .

What is the structural arrangement of MT-ND4L within Complex I?

MT-ND4L is integrated into the membrane arm of Complex I, which has an L-shaped structure consisting of a hydrophobic transmembrane domain and a hydrophilic peripheral arm. MT-ND4L, along with other mitochondrially-encoded subunits (MT-ND1, MT-ND2, MT-ND3, MT-ND4, MT-ND5, and MT-ND6), forms the core of the transmembrane region . These mitochondrially-encoded subunits are characterized by their high hydrophobicity, which facilitates their embedding within the lipid bilayer of the inner mitochondrial membrane.

The transmembrane domain, where MT-ND4L is located, is responsible for proton pumping, while the peripheral arm extending into the mitochondrial matrix contains the NADH binding site and redox centers needed for electron transfer . The specific positioning of MT-ND4L within this complex is critical for maintaining the proton-conducting channels and ensuring the coupling between electron transfer and proton pumping.

What are the optimal storage conditions for preserving the stability of recombinant MT-ND4L?

Based on product information for commercially available recombinant Eulemur mongoz MT-ND4L, the following storage conditions are recommended :

• Buffer composition: Tris-based buffer containing 50% glycerol, specifically optimized for this protein

• Temperature conditions:

  • Short-term storage (up to one week): 4°C

  • Medium to long-term storage: -20°C

  • Extended storage: -80°C

It is explicitly noted that repeated freezing and thawing should be avoided as this can significantly compromise protein integrity . Researchers should aliquot the protein into single-use volumes upon receipt and store working aliquots at 4°C if they will be used within one week.

The high glycerol content (50%) in the storage buffer serves as a cryoprotectant, helping to prevent ice crystal formation that could denature the protein during freeze-thaw cycles. This is particularly important for membrane proteins like MT-ND4L, which tend to be less stable when removed from their native lipid environment.

What techniques can be used to verify the structural integrity of recombinant MT-ND4L?

Verifying the structural integrity of recombinant MT-ND4L requires a multi-faceted approach due to its hydrophobic nature and membrane localization:

• Biochemical validation:

  • SDS-PAGE combined with Western blotting using antibodies specific to MT-ND4L or attached tags

  • Mass spectrometry to confirm the exact molecular weight (expected ~11 kDa) and sequence identity

  • Circular dichroism spectroscopy to assess secondary structure content, particularly the alpha-helical content characteristic of this membrane protein

• Functional assessment:

  • Integration into partial Complex I assemblies to verify proper protein-protein interactions

  • NADH oxidation assays if the protein is incorporated into functional complexes

  • Membrane incorporation assays using model lipid systems

• Biophysical characterization:

  • Thermal stability assays to determine melting temperature and compare with native protein

  • Limited proteolysis to assess proper folding through resistance to enzymatic degradation

  • Intrinsic fluorescence measurements to evaluate tertiary structure

When interpreting results, researchers should consider that removal from the native membrane environment may affect certain structural features of MT-ND4L, and experimental conditions should be optimized to maintain a membrane-like environment during analysis.

How can researchers express recombinant MT-ND4L for functional studies?

Expressing functional recombinant MT-ND4L presents significant challenges due to its hydrophobic nature and normal localization within the mitochondrial membrane. Based on general principles for membrane protein expression and available information on MT-ND4L:

• Expression system selection:

  • Bacterial systems: Specialized E. coli strains designed for membrane protein expression (C41/C43) with codon optimization

  • Eukaryotic systems: Yeast, insect cells, or mammalian cells may provide better folding machinery for this complex protein

  • Cell-free systems: Consider lipid-supplemented cell-free expression systems that can directly incorporate the protein into liposomes

• Expression optimization strategies:

  • Fusion partners: N-terminal fusion with solubility-enhancing tags (MBP, SUMO) with cleavable linkers

  • Temperature modulation: Lower temperatures (16-25°C) to slow folding and prevent aggregation

  • Inducer concentration: Reduced inducer levels to prevent overwhelming the membrane insertion machinery

• Extraction and purification considerations:

  • Detergent screening: Test multiple mild detergents (DDM, LMNG, digitonin) for optimal extraction

  • Buffer optimization: Include glycerol and appropriate salt concentrations as indicated in storage recommendations

  • Purification strategy: Two-step purification combining affinity chromatography with size exclusion chromatography

The experimental approach should be tailored to the specific downstream applications, with particular attention to maintaining the native-like structure of this hydrophobic protein throughout the purification process.

What are the key experimental controls needed when studying MT-ND4L in functional assays?

Robust experimental design for MT-ND4L functional studies requires comprehensive controls to ensure valid interpretations:

• Protein quality controls:

  • Positive control: Native MT-ND4L isolated from mitochondria or well-characterized recombinant preparations

  • Negative control: Denatured MT-ND4L (heat-treated or detergent-treated)

  • Specificity control: Related but functionally distinct Complex I subunit (e.g., another ND subunit)

• Assay-specific controls:

  • For Complex I assembly studies: Samples lacking MT-ND4L versus samples with wild-type protein

  • For activity assays: Specific Complex I inhibitors (e.g., rotenone) to confirm signal specificity

  • For interaction studies: Non-interacting proteins of similar hydrophobicity and size

• Biological system controls:

  • Wild-type versus MT-ND4L knockout/knockdown cells for complementation studies

  • Concentration gradients of recombinant MT-ND4L to establish dose-dependency

  • Time-course experiments to distinguish between immediate and secondary effects

• Technical controls:

  • Multiple biological and technical replicates to ensure reproducibility

  • Multiple methods to confirm the same finding (orthogonal validation)

  • Verification with different tags or tag positions if fusion proteins are used

How does Eulemur mongoz MT-ND4L compare to human MT-ND4L in structural and functional terms?

While direct comparative data between Eulemur mongoz and human MT-ND4L is limited in the search results, several important comparisons can be made based on available information:

These comparisons suggest that while some sequence variations may exist between human and Eulemur mongoz MT-ND4L, the core functional domains are likely highly conserved due to the essential role of this protein in mitochondrial energy production.

What evolutionary patterns have been observed in MT-ND4L across primate species?

Analysis of mitochondrial genomes across primate species reveals several evolutionary patterns relevant to MT-ND4L:

• Sequence diversity patterns:

  • NADH dehydrogenase complex genes, including MT-ND4L, exhibit higher rates of sequence diversity compared to other mitochondrial genes, particularly the cytochrome oxidase (COX) complex genes

  • This diversity is primarily driven by changes at nonsynonymous sites, while synonymous changes show less variation between different mitochondrial genes

• Selection pressure analysis:

  • Despite the higher sequence diversity, MT-ND4L shows evidence of strong purifying selection across primate species

  • The ratio of nonsynonymous to synonymous substitutions (dN/dS) is consistently less than 1, indicating that most amino acid changes are not tolerated

  • No sites under positive selection were identified for MT-ND4L based on Bayesian posterior probabilities

• Rate heterogeneity:

  • The pattern of heterogeneity in evolutionary rates is not even across sites within MT-ND4L and other mitochondrial genes

  • This suggests that certain functional domains within the protein are under stronger evolutionary constraints than others

These evolutionary patterns indicate that while MT-ND4L can accommodate some sequence variation across primate lineages, its core functional domains remain under strong selective constraints, reflecting the essential role of this protein in mitochondrial energy metabolism.

What role does MT-ND4L play in mitochondrial disease pathogenesis?

Based on the available search results, MT-ND4L has been implicated in several mitochondrial pathologies:

• Disease associations in humans:

  • Variants of human MT-ND4L are associated with increased BMI in adults

  • MT-ND4L mutations have been linked to Leber's Hereditary Optic Neuropathy (LHON), a mitochondrial disorder characterized by degeneration of retinal ganglion cells and visual loss

• Pathogenic mechanisms:

  • As a core component of Complex I, mutations in MT-ND4L can disrupt electron transport chain function

  • Disruptions may affect:

    • Complex I assembly and stability

    • NADH dehydrogenase activity

    • Proton pumping efficiency

    • ATP production capacity

    • Reactive oxygen species (ROS) generation

• Experimental insights:

  • While specific disease-associated mutations in Eulemur mongoz MT-ND4L have not been described in the search results, the strong evolutionary conservation of mitochondrial function suggests similar pathogenic mechanisms might apply across primate species

  • The absence of association between MT-ND4L polymorphisms and male infertility in one study suggests that not all variations in this gene are pathogenic

Understanding the pathogenic mechanisms of MT-ND4L mutations can provide valuable insights into mitochondrial disease pathogenesis and potentially inform therapeutic strategies targeting mitochondrial dysfunction.

How can recombinant MT-ND4L be utilized for studying Complex I assembly mechanisms?

Recombinant Eulemur mongoz MT-ND4L offers several strategic approaches for investigating Complex I assembly:

• In vitro reconstitution studies:

  • Step-wise assembly of Complex I subcomplexes with and without MT-ND4L

  • Identification of critical assembly intermediates and their dependencies on MT-ND4L

  • Determination of the temporal sequence of subunit incorporation during Complex I biogenesis

• Interaction mapping:

  • Cross-linking coupled with mass spectrometry to identify direct interaction partners of MT-ND4L

  • Mutagenesis of specific residues to disrupt individual interactions and assess their importance

  • Competition assays with peptides derived from MT-ND4L interaction domains to block specific assembly steps

• Comparative approaches:

  • Parallel analysis of MT-ND4L from Eulemur mongoz and other species to identify conserved assembly mechanisms

  • Chimeric constructs combining segments from different species to map species-specific assembly adaptations

  • Correlation of sequence variations with differences in assembly efficiency or complex stability

• Dynamic assembly monitoring:

  • Fluorescently labeled MT-ND4L to track incorporation into assembling Complex I in real-time

  • Pulse-chase experiments to determine the kinetics of MT-ND4L incorporation

  • Temperature-sensitive variants to conditionally disrupt assembly at specific stages

These approaches can provide valuable insights into the fundamental mechanisms of Complex I assembly, with potential implications for understanding mitochondrial disorders associated with assembly defects.

What mechanisms might explain the higher evolutionary rate of MT-ND4L compared to other mitochondrial genes?

The observed higher evolutionary rate of MT-ND4L and other NADH dehydrogenase complex genes compared to genes like those in the cytochrome oxidase complex may be explained by several mechanisms:

• Functional constraints and structural properties:

  • Different functional roles may impose varying selective pressures on different mitochondrial genes

  • The membrane-embedded nature of MT-ND4L may allow greater tolerance for certain amino acid substitutions that maintain hydrophobicity

  • The position of MT-ND4L within Complex I may subject it to different evolutionary forces than subunits directly involved in electron transfer

• Adaptive evolution considerations:

  • Higher evolutionary rates could reflect adaptation to different metabolic demands across primate lineages

  • Changes in MT-ND4L might compensate for variations in nuclear-encoded Complex I subunits

  • Environmental factors (temperature, diet, activity patterns) may drive species-specific adaptations in energy metabolism

• Molecular evolution dynamics:

  • Despite higher sequence diversity, the consistently low dN/dS ratios (<1) indicate that purifying selection remains strong

  • The pattern of heterogeneity appears to be driven primarily by nonsynonymous sites, suggesting functional significance to observed changes

  • No evidence of sites under positive selection suggests that observed variations may represent neutral or nearly neutral substitutions

Understanding these evolutionary mechanisms can provide insights into the functional constraints on MT-ND4L and potentially reveal regions of the protein that are critical for function versus those that can accommodate species-specific adaptations.

How might the unusual genomic organization of MT-ND4L (gene overlap with MT-ND4) influence its expression and function?

The human MT-ND4L gene exhibits an unusual 7-nucleotide overlap with the MT-ND4 gene, where the reading frames are shifted . This genomic arrangement raises important questions about gene expression and coordination:

• Transcriptional and translational implications:

  • Both genes are likely transcribed as part of a polycistronic transcript from the heavy strand of mitochondrial DNA

  • The overlapping coding regions may influence translation efficiency or coordination

  • This arrangement could ensure stoichiometric production of both proteins, which function together in Complex I

• Evolutionary significance:

  • Conservation of this genomic arrangement across species would suggest functional importance

  • The overlap might represent an evolutionary strategy for genome compaction in the small mitochondrial genome

  • Selective pressure to maintain this arrangement would indicate functional consequences of disrupting it

• Experimental approaches to study this phenomenon:

  • Comparative genomics to determine if this overlap is conserved in Eulemur mongoz

  • Mutagenesis studies altering the overlap region to assess effects on expression and function

  • Reporter systems to monitor translation efficiency across the overlap region

  • Analysis of potential RNA secondary structures that might facilitate translation of both overlapping genes

• Functional coordination hypothesis:

  • The overlap might ensure coordinated expression of these functionally related proteins

  • Physical proximity of newly synthesized proteins could facilitate co-incorporation into Complex I

  • Mutations affecting the overlap region might have pleiotropic effects on both proteins

This unusual genomic feature provides a fascinating case study in mitochondrial gene organization and expression, with potential implications for understanding the coordinated assembly of multisubunit complexes.

What are common challenges in working with recombinant MT-ND4L and how can they be addressed?

Working with recombinant MT-ND4L presents several technical challenges due to its hydrophobic nature and membrane protein characteristics:

• Expression and solubility issues:

  • Challenge: Poor expression and inclusion body formation

  • Solutions:

    • Use specialized strains designed for membrane protein expression

    • Employ fusion tags that enhance solubility (MBP, SUMO)

    • Reduce expression temperature and inducer concentration

    • Consider cell-free expression systems with added lipids or detergents

• Protein aggregation during purification:

  • Challenge: Loss of solubility during extraction and purification

  • Solutions:

    • Screen multiple detergents and detergent concentrations

    • Include stabilizers like glycerol in all buffers (as recommended in storage conditions)

    • Minimize exposure to air/foam and maintain low temperatures

    • Consider on-column refolding if recovery from inclusion bodies is necessary

• Functional verification difficulties:

  • Challenge: Assessing function of an individual subunit normally part of a large complex

  • Solutions:

    • Develop partial assembly assays with key interaction partners

    • Use surrogate activity assays focusing on specific aspects of function

    • Compare with native MT-ND4L isolated from mitochondria as a positive control

    • Implement multiple orthogonal approaches to assess structure and function

• Storage instability:

  • Challenge: Loss of activity during storage

  • Solutions:

    • Follow recommended storage in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

    • Store working aliquots at 4°C for no more than one week

    • Consider addition of reducing agents if cysteine oxidation is a concern

Addressing these challenges requires careful optimization at each step of the experimental workflow and may necessitate compromises between yield, purity, and functional integrity.

How can researchers distinguish between effects specific to MT-ND4L and broader impacts on Complex I function?

Differentiating MT-ND4L-specific effects from general Complex I disruptions requires carefully designed experimental approaches:

• Complementation and rescue studies:

  • Selective depletion of endogenous MT-ND4L (RNA interference or CRISPR techniques)

  • Rescue experiments with wild-type versus mutant MT-ND4L

  • Comparison with depletion of other Complex I subunits to identify unique phenotypes

  • Cross-species complementation to map functionally conserved regions

• Structure-function analysis:

  • Site-directed mutagenesis targeting specific residues unique to MT-ND4L

  • Domain swapping between MT-ND4L and related proteins

  • Creation of chimeric proteins containing segments from different species

  • Correlation of structural changes with specific functional outcomes

• Staged analytical approach:

  • Begin with broad assays (cellular respiration, ATP levels)

  • Progress to Complex I-specific measurements (NADH:ubiquinone oxidoreductase activity)

  • Further refine to MT-ND4L-specific aspects (incorporation into Complex I, specific protein-protein interactions)

  • Correlate biochemical findings with structural data when available

• Multiple experimental models:

  • Compare results across different cell types and species

  • Use both in vitro reconstituted systems and cellular models

  • Implement acute interventions (direct protein addition) and chronic approaches (stable expression)

  • Validate key findings using native mitochondrial preparations

This multi-faceted approach can help establish causality between MT-ND4L perturbations and observed functional effects, distinguishing direct impacts from secondary consequences.

What quality control parameters should be assessed when working with recombinant MT-ND4L?

When working with the commercially available recombinant Eulemur mongoz MT-ND4L, researchers should note that it is typically supplied at a quantity of 50 μg in a Tris-based buffer with 50% glycerol . This quantity is sufficient for most analytical quality control procedures but may need to be supplemented for extensive functional studies or applications requiring larger amounts of protein.