Recombinant Eumetopias jubatus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a mitochondrial gene-encoded protein subunit of Complex I (NADH dehydrogenase), a critical component of the electron transport chain (ETC) in mitochondria. The recombinant form derived from Eumetopias jubatus (Steller sea lion) is a bioengineered protein designed for structural, functional, or immunological studies.

Role in Complex I

  • Core Function: Facilitates electron transfer from NADH to ubiquinone and participates in proton translocation across the mitochondrial inner membrane .

  • Gene Overlap: In humans, MT-ND4L overlaps with MT-ND4 (7-nucleotide overlap), a feature conserved in some eukaryotes .

  • Protein Architecture: Contains hydrophobic α-helices forming part of Complex I’s membrane arm, as resolved in cryo-EM structures .

Recombinant Production and Specification

The Eumetopias jubatus recombinant MT-ND4L is produced via heterologous expression systems, typically in E. coli or yeast.

Production and Handling

ParameterDetailSource
Expression SystemE. coli or yeast
Storage-20°C/-80°C (lyophilized) or 4°C (working aliquots)
ReconstitutionDeionized water with 5–50% glycerol (final concentration)
Purification MethodAffinity chromatography (His-tag)

Research Applications and Significance

While direct studies on Eumetopias jubatus MT-ND4L are sparse, its recombinant form is valuable for:

Potential Uses

  1. Structural Studies:

    • Cryo-EM or X-ray crystallography to resolve species-specific interactions in Complex I .

  2. Disease Modeling:

    • Investigating mitochondrial disorders linked to Complex I dysfunction (e.g., Leber hereditary optic neuropathy) .

  3. Immunological Assays:

    • ELISA or Western blotting to detect MT-ND4L expression or antibodies in marine mammal models .

Comparative Analysis with Other Species’ Recombinant Forms

SpeciesExpression SystemPurity (%)Key ApplicationsSource
Eumetopias jubatusN/A>85Immunological studies, structural biology
Homo sapiensYeast>85Complex I dysfunction research
Acinonyx jubatusE. coli>90Enzymatic studies, protein folding

Challenges and Future Directions

  • Limited Data: No peer-reviewed studies specifically on Eumetopias jubatus MT-ND4L exist.

  • Functional Validation: Requires assays to confirm catalytic activity or integration into Complex I.

  • Species-Specific Insights: Comparative studies with human or model organism homologs could elucidate evolutionary adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Eumetopias jubatus (Steller sea lion) (Phoca jubata)
Target Names
Target Protein Sequence
MSMVYFNILMAFIVSFVGLLMYRSHLMSSLLCLEGMMLSLFVMMSVTILNNHFTLASMAP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How do mutations in MT-ND4L potentially impact mitochondrial function and disease pathology?

    Studies across species have identified several mutation impacts:

    • The rs28709356 C>T variant in human MT-ND4L shows significant association with Alzheimer's disease risk (p = 7.3 × 10⁻⁵)

    • In Leber Hereditary Optic Neuropathy (LHON), the T10663C (Val65Ala) mutation alters protein structure by replacing valine with alanine at position 65

    • Mutations affecting Complex I function can lead to increased ROS production, reduced ATP synthesis, and altered mitochondrial membrane potential

    Methodologically, researchers investigating MT-ND4L mutations should:

    1. Employ whole exome sequencing with specialized mitochondrial genome assembly pipelines

    2. Use SKAT-O or similar statistical approaches for gene-based association testing

    3. Validate findings with functional assays measuring Complex I activity (NADH-Ubiquinone Oxidoreductase method)

    4. Assess impact on mitochondrial respiratory capacity and ROS production

    The association of MT-ND4L variants with neurodegenerative diseases suggests its importance in tissues with high energy demands, though specific mechanisms remain under investigation .

  • What methodologies are most effective for studying MT-ND4L activity in comparative species research?

    When investigating MT-ND4L across species including Eumetopias jubatus:

    1. Complex I Activity Assays:

      • NADH-Ubiquinone Oxidoreductase method using spectrophotometry

      • Normalization to citrate synthase activity to account for mitochondrial content differences

      • Comparison of activity under varied substrate conditions to assess functional differences

    2. Mitochondrial Respiration Analysis:

      • High-resolution respirometry

      • Oxygen consumption rate measurement with specific Complex I substrates

      • Inhibitor titration studies using rotenone to isolate Complex I contribution

    3. Genetic Analysis:

      • PCR amplification of MT-ND4L with species-specific primers

      • Analysis of common deletions spanning the MT-ND4L region

      • Sequencing approaches for detecting heteroplasmy and minor variants

    4. Recombinant Protein Studies:

      • Expression in bacterial or mammalian systems

      • Reconstitution studies with other Complex I components

      • Site-directed mutagenesis to assess functional impacts of variants

    These methodologies enable investigation of both genetic variation and functional consequences in comparative studies.

  • What are the challenges and solutions for working with recombinant Eumetopias jubatus MT-ND4L in experimental systems?

    Key Challenges:

    1. Hydrophobicity: MT-ND4L is highly hydrophobic, making expression and purification difficult

    2. Proper folding: Ensuring correct conformation when expressed outside mitochondrial environment

    3. Species-specific optimization: Expression systems may require adjustment for sea lion proteins

    4. Functional assays: Difficulty in reconstituting functional Complex I for activity measurements

    Methodological Solutions:

    1. Expression Systems:

      • Use of specialized expression vectors with fusion tags to improve solubility

      • Expression in membrane-mimetic environments using nanodiscs or liposomes

      • Codon optimization for the expression host

    2. Purification Strategies:

      • Detergent screening for optimal solubilization

      • Use of stabilizing additives in buffers (glycerol 50%)

      • Chromatography methods optimized for hydrophobic proteins

    3. Storage Conditions:

      • Store at -20°C with 50% glycerol or -80°C for extended storage

      • Avoid repeated freeze-thaw cycles

      • Use working aliquots stored at 4°C for up to one week

    4. Validation Methods:

      • Antibody-based detection using conserved epitopes

      • Mass spectrometry for identity confirmation

      • Blue native PAGE for complex assembly verification

  • How does MT-ND4L potentially contribute to environmental adaptation in marine mammals?

    Studies on mitochondrial genes across species living in different environments provide insights:

    1. High-Altitude Adaptation Model:

      • Certain MT-ND4L haplotypes (similar to Ha1) show positive association with high-altitude adaptability in Tibetan yaks and cattle (p < 0.0017)

      • Similar mechanisms may apply to marine mammal adaptation to hypoxic diving conditions

    2. Diving Physiology Adaptations:

      • Marine mammals like Eumetopias jubatus experience regular hypoxia during dives

      • MT-ND4L variations may optimize electron transport efficiency under low oxygen conditions

      • More efficient Complex I function could reduce ROS production during reoxygenation events

    3. Thermal Adaptation:

      • MT-ND4L sequence variations may alter proton pumping efficiency

      • Potential contribution to thermoregulation in cold marine environments

    4. Research Approaches:

      • Comparative genetic analysis across marine mammals with different diving capacities

      • Functional studies comparing recombinant MT-ND4L from different species

      • Correlation of genetic variants with physiological parameters like diving capacity and metabolism

    The study of MT-ND4L in Eumetopias jubatus provides a valuable model for understanding mitochondrial adaptations to extreme environments.

Advanced Technical Questions

  • How does the mitochondrial genetic code affect recombinant expression of Eumetopias jubatus MT-ND4L?

    The mitochondrial genetic code differs from the standard nuclear code, creating challenges for recombinant expression:

    1. Code Differences:

      • In mitochondria, AUA codes for methionine (not isoleucine)

      • UGA codes for tryptophan (not stop)

      • The initiation codon often retains its N-α-formyl methionine in mitochondrially encoded proteins

    2. Expression Strategies:

      • Recoding the MT-ND4L sequence for standard genetic code expression

      • Codon optimization for the host expression system

      • Use of specialized strains capable of recognizing mitochondrial code

    3. Post-translational Considerations:

      • N-terminal processing differences between mitochondrial and recombinant expressions

      • Potential impact on protein folding and function

      • Need for validation of recombinant protein structure against native form

    4. Validation Approaches:

      • Mass spectrometry to confirm correct translation

      • Functional assays comparing native and recombinant proteins

      • Structural analysis to confirm proper folding

    Understanding these differences is crucial for producing functionally equivalent recombinant MT-ND4L for research applications.

  • What insights can comparative studies of MT-ND4L provide about evolution and adaptation in marine mammals?

    Comparative analysis of MT-ND4L across marine mammals offers valuable evolutionary insights:

    1. Phylogenetic Applications:

      • MT-ND4L sequence analysis can help resolve taxonomic relationships

      • The close relationship between Juan Fernandez fur seal and Galapagos fur seal shows low interspecific divergence despite geographic separation

      • Mitochondrial control region haplotype networks can reveal population structure and history

    2. Selection Pressure Analysis:

      • Ratio of non-synonymous to synonymous substitutions (dN/dS) indicates selection pressure

      • Identification of sites under positive selection may reveal adaptive mutations

      • Comparison between diving and non-diving mammals reveals functional adaptations

    3. Methodological Approaches:

      • Multiple sequence alignment of MT-ND4L across marine mammals

      • Bayesian phylogenetic reconstruction

      • Tests for selection including McDonald-Kreitman and HKA tests

    4. Integrative Analysis:

      • Correlation of genetic variation with diving physiology data

      • Mapping variants to protein structure to identify functional impacts

      • Comparative biochemistry of recombinant proteins from different species

    These comparative approaches provide insights into how MT-ND4L has evolved to support the specialized physiological demands of marine mammals like Eumetopias jubatus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.