Recombinant Eumops glaucinus Cytochrome b (MT-CYB)

What is the amino acid sequence of Eumops glaucinus Cytochrome b?

The complete amino acid sequence of Eumops glaucinus Cytochrome b consists of 176 amino acids: MTNIRKSHPLIKIVNDAFIDLPAPSNISSWWNFGSLLGICLAVQILTGLFLAMHYTSDTATATAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGVILLFAVMATAFMGYVLPWGQMSSWGATVITNLLSAIPYMGTDLVGWIWGGFSVDKATLT . This sequence information is crucial for understanding protein structure-function relationships and conducting comparative genomic analyses between species.

What are the alternative names and gene identifiers for MT-CYB in research literature?

MT-CYB has several alternative designations in scientific literature. The recommended name is Cytochrome b, but it is also known as Complex III subunit 3, Complex III subunit III, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit. The gene names include MT-CYB (primary) with synonyms COB, CYTB, and MTCYB . The UniProt accession number for Eumops glaucinus Cytochrome b is Q34462 . Using consistent nomenclature is essential for accurate literature searches and cross-referencing research findings.

How does Cytochrome b function in the mitochondrial electron transport chain?

Cytochrome b functions as a critical component of Complex III (ubiquinol-cytochrome c reductase) in the mitochondrial electron transport chain. The protein spans the inner mitochondrial membrane and facilitates electron transfer from ubiquinol to cytochrome c while simultaneously pumping protons across the membrane. This process contributes to establishing the proton gradient necessary for ATP synthesis. Mutations in this gene can disrupt electron transport efficiency, potentially leading to mitochondrial dysfunction and associated pathologies . Research methodologies targeting MT-CYB often focus on assessing electron transport chain functionality through measurements of membrane potential, oxygen consumption, and ATP production.

What are the optimal storage conditions for recombinant MT-CYB protein in experimental settings?

For optimal stability and activity of recombinant Eumops glaucinus Cytochrome b, the recommended storage conditions are: store at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically maintained in a Tris-based buffer containing 50% glycerol, specifically optimized for this protein . For working solutions, store aliquots at 4°C for up to one week, but avoid repeated freeze-thaw cycles as they significantly diminish protein stability and activity . Researchers should validate protein integrity after storage using appropriate activity assays or structural characterization methods such as circular dichroism or thermal shift assays.

What PCR and sequencing protocols are most effective for MT-CYB amplification and analysis?

Effective amplification of the MT-CYB gene requires carefully designed primers that account for potential species-specific variations. Standard PCR protocols have proven successful for most Molossid and Vespertilionid species, though specialized primers may be necessary for certain genera like Eptesicus . For sequencing, the Sanger method has been effectively employed to identify single nucleotide polymorphisms (SNPs) in the MT-CYB gene . Analysis of sequencing data typically involves specialized software such as Mutation Surveyor for SNP identification and FinchTV for genotyping . For phylogenetic analyses, both maximum-likelihood and Bayesian methods have been successfully applied to MT-CYB sequence data .

How should researchers design experiments to study MT-CYB mutations and their phenotypic effects?

When designing experiments to study MT-CYB mutations and their phenotypic effects, researchers should implement a comprehensive approach that includes:

• Sample selection: Include both affected and control groups with appropriate sample sizes for statistical power (typically >40 per group as seen in previous studies)

• Genotyping approach: Employ direct sequencing of the complete MT-CYB gene to identify all potential variants

• Statistical analysis: Use chi-square tests and Fischer's exact test for genotype and allele frequency comparisons, with odds ratios and 95% confidence intervals for effect size estimation

• Phenotypic correlation: Measure relevant physiological parameters that may be affected by mitochondrial dysfunction

• Validation: Confirm significant findings through functional studies that assess the impact of identified mutations on protein structure and mitochondrial performance

This methodological framework has successfully identified significant associations between MT-CYB polymorphisms and physiological conditions in previous research .

How effective is MT-CYB for species-level identification in chiropteran taxonomy?

MT-CYB has demonstrated variable effectiveness for species-level identification in chiropteran taxonomy, with its resolution depending on the genus under investigation. Studies have shown that cytochrome b can provide:

• High resolution: Successful species-level delimitation in non-conflicting genera such as Eumops, Dasypterus, and Molossops

• Moderate resolution: Infrageneric discrimination in more complex lineages including Eptesicus, Myotis, and Molossus

Researchers should consider that MT-CYB-based phylogenies may be affected by four potential sources of incongruence:

• Molecular processes (such as incomplete lineage sorting)

• Biological factors (hybridization or introgression)

• Limitations in morphological identification

• Errors in current taxonomic classification

For optimal taxonomic resolution, MT-CYB should be used in conjunction with other molecular markers (nuclear DNA) and traditional morphological analyses.

What are the advantages of combining MT-CYB with other genetic markers for phylogenetic studies?

Combining MT-CYB with other genetic markers offers significant advantages for robust phylogenetic analyses:

• Complementary resolution: While MT-CYB provides strong maternal lineage information, nuclear markers like β-fibrinogen intron 7 (βFib) can resolve deeper evolutionary relationships and reflect biparental inheritance

• Discordance detection: Using multiple loci can identify instances of incomplete lineage sorting, hybridization, or introgression that would be missed with a single marker

• Increased statistical support: Combined analyses of multiple loci (such as MT-CYB with ND1 and βFib) typically provide higher statistical support for phylogenetic relationships

• Temporal calibration: Multiple markers with different mutation rates allow for better estimation of divergence times, as demonstrated in studies of Eumops that dated the most recent common ancestor to approximately 15.7 million years ago

Methodologically, Bayesian inference and Bayesian concordance analysis of concatenated sequences (totaling 2,715 base pairs across multiple markers) have proven effective for generating well-supported phylogenies .

What types of mutations have been identified in MT-CYB and how are they classified?

Research has identified several types of mutations in the MT-CYB gene, which can be classified as follows:

• Non-synonymous variants (missense): These alter the amino acid sequence and potentially protein function. Examples include:

  • rs2853508, rs28357685, rs41518645, rs2853507

  • rs28357376 (A>G at position 15824, causing Thr360Ala substitution)

  • rs35070048 (A>G at position 15311, causing Ile189Val substitution)

  • rs2853506 (A>G at position 15218, causing Thr158Ala substitution)

• Synonymous variants: These do not change the amino acid sequence but may affect mRNA stability or translation. Examples include:

  • rs527236194 (T15784C)

  • rs28357373 (T15629C)

  • rs28357369 (A>G at position 15244)

  • rs41504845 (C15833T)

  • rs2854124 (C>T at position 15136)

Classification of these mutations typically involves bioinformatic analyses to predict their functional impact, followed by experimental validation through biochemical and cellular assays.

How do specific MT-CYB mutations correlate with physiological conditions or pathologies?

MT-CYB mutations have been associated with various physiological conditions and pathologies through careful correlation studies. Key findings include:

• Male subfertility correlation: Significant associations were found between male subfertility and specific MT-CYB polymorphisms:

  • rs527236194 (T15784C): p = 0.0005 for genotype frequency, p = 0.0014 for allelic frequency

  • rs28357373 (T15629C): p = 0.0439 for genotype frequency

  • rs41504845 (C15833T): p = 0.0038 for genotype frequency, p = 0.0147 for allelic frequency

• COVID-19 susceptibility: Specific mutations in the CYB gene have been correlated with COVID-19 susceptibility:

  • A15326G: p < 0.0001, OR (95% CI): 4.966 (2.215−10.89)

  • T15454C: p = 0.0226

  • C15452A: significant association (p value not specified)

These correlations were established through case-control studies with statistical analyses of genotype and allele frequencies, highlighting the importance of mitochondrial genetics in various physiological and pathological conditions.

Table 1: Comparison of clinical parameters between fertile and subfertile groups in MT-CYB mutation study

How can recombinant MT-CYB be utilized for structure-function relationship studies?

Recombinant MT-CYB provides a valuable tool for structure-function relationship studies through several methodological approaches:

• Site-directed mutagenesis: Introducing specific mutations identified in natural populations (such as those associated with subfertility or other conditions) allows researchers to directly test the functional consequences of these variants

• Protein crystallography and structural biology: Purified recombinant MT-CYB can be used for structural determination, providing insights into how specific amino acid residues contribute to protein folding, stability, and function

• Reconstitution experiments: Incorporating recombinant MT-CYB into artificial membrane systems or depleted mitochondria can assess its role in electron transport chain assembly and function

• Protein-protein interaction studies: Using techniques such as co-immunoprecipitation, cross-linking, or surface plasmon resonance with recombinant MT-CYB to identify interaction partners and characterize binding interfaces

• Comparative biochemistry: Analyzing recombinant MT-CYB from different species (such as Eumops glaucinus) to understand evolutionary adaptations in mitochondrial function across taxa

These approaches can provide critical insights into how MT-CYB structure relates to its function in cellular energy production and how mutations may disrupt these processes.

What are the challenges and solutions in expressing functional recombinant MT-CYB in heterologous systems?

Expressing functional recombinant MT-CYB in heterologous systems presents several challenges that require specific solutions:

• Membrane protein expression: As an integral membrane protein, MT-CYB is often difficult to express in soluble, correctly folded form. Solutions include:

  • Using specialized expression vectors with fusion tags that enhance solubility

  • Employing membrane-mimetic systems such as nanodiscs or liposomes during purification

  • Optimizing detergent selection for extraction and purification

• Codon optimization: The evolutionary distance between Eumops glaucinus and common expression hosts may necessitate codon optimization to match the host's tRNA pool

• Post-translational modifications: Ensuring proper incorporation of heme groups that are essential for MT-CYB function requires supplementation of culture media or co-expression of heme biosynthesis enzymes

• Functional validation: Confirming that recombinant MT-CYB retains native structure and function through:

  • Spectroscopic analyses to verify heme incorporation

  • Electron transfer activity assays

  • Membrane integration assessment

• Storage stability: Maintaining protein activity during storage requires specific buffer conditions, such as the Tris-based buffer with 50% glycerol described for commercial preparations

Researchers can overcome these challenges through systematic optimization of expression conditions and careful functional characterization of the recombinant protein.

How does MT-CYB sequence variation inform our understanding of bat evolution and ecology?

MT-CYB sequence variation has provided critical insights into bat evolution and ecology through several analytical approaches:

• Divergence time estimation: Analysis of MT-CYB sequences has helped establish evolutionary timelines, such as dating the most recent common ancestor of the Eumops genus to approximately 15.7 million years ago

• Phylogeographic patterns: MT-CYB variation across geographical regions reveals population structure and historical migration patterns in bat species, informing conservation strategies

• Adaptive evolution: Comparative analysis of selection pressures on MT-CYB across bat species living in different ecological niches can reveal adaptive changes in energy metabolism

• Species delimitation: In conjunction with morphological data, MT-CYB has helped resolve taxonomic uncertainties in bat classification, particularly in genera like Eumops where it has shown heterogeneous taxonomic resolution

• Molecular systematics: MT-CYB data have contributed to reconstructing phylogenetic relationships within the Molossidae family, challenging and refining previous classifications based solely on morphological characteristics

These applications demonstrate how MT-CYB sequence data extends beyond simple species identification to address fundamental questions in evolutionary biology.

What does comparative analysis of MT-CYB across chiropteran species reveal about mitochondrial evolution?

Comparative analysis of MT-CYB across chiropteran species has revealed several important aspects of mitochondrial evolution:

• Variable evolutionary rates: Phylogenetic studies have detected heterogeneous rates of molecular evolution in MT-CYB across bat lineages, potentially reflecting different selective pressures related to metabolic demands or ecological adaptations

• Functional constraints: Certain regions of MT-CYB show higher conservation across bat species, suggesting functional constraints on these domains that are critical for electron transport activity

• Lineage-specific adaptations: Unique substitutions in MT-CYB sequences of certain bat lineages may represent adaptations to specific ecological niches or physiological demands, such as the high energy requirements of flight

• Taxonomic utility: The variable resolution of MT-CYB across different bat genera highlights the complex nature of molecular evolution, where some lineages show clear species boundaries while others display more complex patterns due to recent divergence or hybridization events

• Concordance with nuclear markers: Combined analysis of MT-CYB with nuclear markers like βFib has revealed instances of discordance that provide insights into processes such as incomplete lineage sorting, introgression, or hybridization in bat evolution

These findings underscore the value of MT-CYB as a marker for understanding both the phylogenetic relationships and evolutionary processes in Chiroptera.