Recombinant Eumops perotis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Eumops perotis (Western bonneted bat) (Molossus perotis)
Target Names
Target Protein Sequence
MTNIRKSHPLIKIVNEAFIDLPAPSNISSWWNFGSLLGVCLTMQIMTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGIILL FAVMATAFMGYVLPWGQMSSWGATVITNLLSAIPYIGTDLVGWIWGGFSVDKATLT
Uniprot No.

Target Background

Function

Recombinant Eumops perotis Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently utilized for ATP synthesis.

Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Eumops perotis Cytochrome b and why is it significant for research?

Cytochrome b is a mitochondrial DNA-encoded protein that functions as a critical component of the electron transport chain's complex III. In Eumops perotis (greater mastiff bat), this gene has particular significance for several research applications:

  • Taxonomic resolution: MT-CYB serves as a valuable marker for species identification and phylogenetic studies in bats due to its appropriate mutation rate and conserved regions .

  • Evolutionary studies: The gene provides insights into the evolutionary relationships among bat species, particularly within the family Molossidae to which Eumops perotis belongs .

  • Functional research: As part of the respiratory chain, MT-CYB's structure and mutations can reveal adaptations specific to the high-energy flight requirements of these large bats.

Eumops perotis is a particularly interesting species as it is one of the largest bats in North America with distinctive morphological features, making its molecular characteristics valuable for comparative studies .

What are the recommended protocols for extracting mitochondrial DNA from Eumops perotis tissue samples?

For optimal extraction of mitochondrial DNA containing the MT-CYB gene from Eumops perotis:

  • Tissue selection: Wing membrane biopsies (3-5 mm diameter) are preferred for non-lethal sampling. Alternatively, liver or muscle tissue can be used from preserved specimens.

  • Preservation method: Immediately place fresh tissue in 95% ethanol or RNA-later solution and store at -20°C for short-term or -80°C for long-term preservation.

  • Extraction protocol:

    • Commercial kits (e.g., QIAGEN DNeasy Blood & Tissue Kit) modified for highly fibrous bat wing membranes

    • For museum specimens, specialized ancient DNA protocols may be required

    • Include additional purification steps to remove PCR inhibitors common in bat tissues

Important considerations:

  • PCR amplification of the full MT-CYB gene (approximately 1140 bp) may require multiple overlapping primer sets

  • Tissue collection should adhere to ethical guidelines for bat research, especially given the protected status of many bat populations .

What primer sets are most effective for amplifying the complete MT-CYB gene from Eumops perotis?

Based on research using cytochrome b for bat species identification, the following primer combinations have proven effective:

Table 1: Recommended Primer Sets for Eumops perotis MT-CYB Amplification

Primer PairSequence (5' to 3')Target RegionFragment Size (bp)Annealing Temp (°C)
Bat-CytB-F1CATAGCCAACGCACTAATCAC5' region~45055
Bat-CytB-R1GTCTTGTAAACCGGAGCTAGG5' region~45055
Bat-CytB-F2CTACGGCTCATACCTCAAAGMiddle region~40054
Bat-CytB-R2CTCCTAGTTTATTAGGACTCCTGMiddle region~40054
Bat-CytB-F3GAGGACAAATATCATTCTGAGG3' region~45056
Bat-CytB-R3TAGGCRAATAGGAARTATCATTC3' region~45056

For heterologous expression systems, modified primers with appropriate restriction sites and kozak sequences should be designed based on the complete sequence .

What are the key considerations for expressing recombinant Eumops perotis MT-CYB in bacterial systems?

Expressing functional mitochondrial proteins like cytochrome b in bacterial systems presents several challenges that require optimization:

  • Codon optimization: Mitochondrial genetic code differs from bacterial code; therefore, sequence modification is essential:

    • ATA (isoleucine in standard code) codes for methionine in mitochondria

    • TGA (stop codon in standard code) codes for tryptophan in mitochondria

  • Membrane protein expression strategies:

    • Use of specialized E. coli strains (e.g., C41(DE3), C43(DE3)) designed for membrane proteins

    • Fusion with solubility tags (MBP, SUMO, Thioredoxin)

    • Lower induction temperatures (16-18°C) to reduce inclusion body formation

  • Heme incorporation:

    • Supplement media with δ-aminolevulinic acid (50-100 μg/ml)

    • Co-express with cytochrome c heme lyase to facilitate proper heme attachment

  • Purification considerations:

    • Use mild detergents (DDM, LMNG) for membrane extraction

    • Implement two-step chromatography (affinity followed by size exclusion)

When designing constructs, note the topology of cytochrome b with its eight transmembrane helices, which makes expression challenging compared to soluble proteins .

How can researchers distinguish between mutations in the MT-CYB gene that affect function versus those that represent taxonomic variation?

Distinguishing functional from neutral mutations in MT-CYB requires multiple analytical approaches:

  • Sequence conservation analysis:

    • Compare across diverse bat species to identify highly conserved residues likely critical for function

    • Mutations in conserved regions (particularly in heme-binding domains) are more likely to affect function

    • Focus on cysteine residues that are often critical for structure and function, as seen in the m.14864 T>C mutation described in human MT-CYB that changes a conserved cysteine to arginine

  • Structural mapping:

    • Map mutations onto predicted 3D structures using homology modeling

    • Evaluate proximity to functional sites (heme binding, quinone binding, transmembrane regions)

  • Functional assays:

    • Electron transfer activity measurements using recombinant proteins

    • Respiratory chain complex III activity assays

    • Membrane potential measurements in mitochondrial or bacterial systems

  • Statistical tests for selection pressure:

    • dN/dS ratios to assess negative or positive selection

    • McDonald-Kreitman test to compare fixed differences between species versus polymorphisms

Example analysis approach: Conservative amino acid substitutions in variable regions of the protein are more likely to represent taxonomic variation, while non-conservative changes in conserved regions (particularly at positions 40, 158, and 271) may impact function .

What are the best approaches for resolving discrepancies in phylogenetic analyses based on Eumops perotis MT-CYB sequences?

When MT-CYB gene sequences produce phylogenies that conflict with other molecular markers or morphological data:

  • Evaluate potential sources of error:

    • Nuclear mitochondrial DNA segments (NUMTs) contamination

    • Introgression or hybridization events

    • Heteroplasmy in mitochondrial DNA

    • Long-branch attraction artifacts

  • Multi-gene approach:

    • Combine MT-CYB with other mitochondrial genes (COI, 16S rRNA)

    • Include nuclear markers (RAG2, BRCA1) for comparative analyses

    • Construct species trees rather than gene trees using methods like *BEAST

  • Advanced phylogenetic methods:

    • Partition data by codon position

    • Apply mixed models of sequence evolution

    • Use Bayesian approaches with appropriate priors based on bat evolutionary rates

    • Implement coalescent-based species tree estimation

  • Taxonomic sampling considerations:

    • Include multiple specimens per species to account for intraspecific variation

    • Ensure adequate sampling of closely related Eumops species (E. auripendulus, E. bonariensis, E. dabbenei, E. glaucinus, E. hansae, E. maurus, and E. underwoodi)

Heterogeneous taxonomic resolution has been observed in bat cytochrome b studies, suggesting that this marker alone may not fully resolve all taxonomic relationships, particularly among closely related species .

How does the structure of Eumops perotis MT-CYB compare to cytochrome b from other mammalian species?

Comparing the structural features of Eumops perotis MT-CYB with other mammals reveals important evolutionary adaptations:

  • Primary structure comparison:

    • Eumops perotis MT-CYB contains approximately 380 amino acids, similar to other mammals

    • Key differences are observed in regions associated with thermostability and energy efficiency

    • Several bat-specific amino acid substitutions appear to correlate with high-energy flight requirements

  • Structural motifs:

    • Conserved CXXCH motifs for heme binding, though positioned differently than in bacterial cytochromes

    • Transmembrane helices show higher conservation than loop regions

    • Quinone binding sites display bat-specific adaptations

  • Molecular modeling analysis:

    • Homology models based on bovine or porcine cytochrome b crystal structures reveal subtle differences in the positioning of functional domains

    • Loop regions connecting transmembrane helices show greater variability among species

    • Potential adaptations in the proton translocation pathway may correlate with metabolic requirements

Table 2: Key MT-CYB Structural Features Comparison

FeatureEumops perotisOther BatsNon-flying Mammals
Transmembrane helices888
Heme binding sites222
Quinone binding sitesModified Q₀ siteSimilar modifications in high-flight batsStandard configuration
Loop region lengthShortenedVariableGenerally longer
Thermostability motifsEnhancedEnhanced in migratory speciesStandard

These structural differences may reflect adaptations to the high metabolic demands of flight and the ecological niche occupied by Eumops perotis .

What effect do post-translational modifications have on recombinant Eumops perotis MT-CYB functionality?

Post-translational modifications (PTMs) significantly impact the functionality of recombinant MT-CYB and must be considered when designing expression systems:

  • Critical PTMs for cytochrome b function:

    • Heme incorporation: Two heme B groups must be properly incorporated into the protein

    • Membrane insertion: Proper folding requires coordinated insertion into the lipid bilayer

    • Interaction with iron-sulfur protein and cytochrome c₁: Assembly into functional complex III

  • Challenges in recombinant systems:

    • Bacterial systems lack mitochondrial membrane insertion machinery

    • Eukaryotic systems may introduce non-native PTMs

    • Heme incorporation may be inefficient in heterologous systems

  • Detection methods for PTMs:

    • Absorption spectroscopy to confirm heme incorporation (peaks at ~562 nm and ~530 nm)

    • Mass spectrometry to identify other modifications

    • Functional assays to assess electron transfer capacity

  • Optimization strategies:

    • Co-expression with bat-specific assembly factors

    • Modified membrane-mimetic systems (nanodiscs, liposomes)

    • Directed evolution approaches to enhance folding and stability

For functional studies, maintaining native-like membrane environments is crucial, as complex III activity depends on proper lipid interactions and supramolecular assembly .

How can recombinant Eumops perotis MT-CYB be used to study bat-specific adaptations to high metabolic demands?

Recombinant MT-CYB offers several approaches to investigate metabolic adaptations in bats:

  • Comparative functional analysis:

    • Measure electron transfer rates of recombinant MT-CYB from Eumops perotis versus other mammals

    • Assess efficiency under varying temperature conditions to understand thermal adaptations

    • Compare oxygen affinity and ROS production between bat and non-bat cytochrome b

  • Directed mutagenesis studies:

    • Generate chimeric proteins with domains from different species

    • Introduce bat-specific amino acid substitutions into non-bat cytochrome b

    • Revert bat-specific substitutions to ancestral states to assess functional impact

  • Metabolic flux analysis:

    • Incorporate recombinant bat proteins into membrane systems to measure respiratory chain kinetics

    • Assess influence on proton translocation efficiency

    • Compare energy coupling under conditions simulating flight metabolism

  • Structural adaptations:

    • Analyze protein stability under varying temperatures and pH conditions

    • Assess structural flexibility through hydrogen-deuterium exchange experiments

    • Evaluate resistance to oxidative stress compared to non-flying mammals

The large body size of Eumops perotis (157-184 mm total length) combined with its specialized flight adaptations makes it an excellent model for understanding metabolic efficiency in flying mammals .

What are the best practices for using Eumops perotis MT-CYB in molecular clock analyses?

When using MT-CYB for molecular dating and divergence time estimation:

  • Calibration strategies:

    • Use fossil records of Molossidae family bats as primary calibration points

    • Apply secondary calibrations from comprehensive mammalian phylogenies

    • Implement cross-validation of multiple calibration points

  • Substitution rate considerations:

    • Account for lineage-specific rate variation in bats

    • Apply relaxed clock models (uncorrelated lognormal or exponential) rather than strict clocks

    • Partition data by codon position with separate substitution models

  • Analytical approaches:

    • Bayesian methods (BEAST, MrBayes) with appropriate priors on node ages

    • Maximum likelihood with penalized likelihood rate smoothing

    • Total Evidence Dating incorporating morphological and molecular data

  • Validation methods:

    • Compare results using different calibration schemes

    • Assess sensitivity to prior distributions

    • Cross-validate with independent molecular markers

Table 3: Key Calibration Points for Molossid Bat Molecular Clock Analyses

NodeFossil EvidenceEstimated Age (MYA)Reference
Crown MolossidaeEarliest molossid fossils37-40Paleontological record
Eumops genusFirst Eumops fossils15-20Molecular studies
Eumops perotis cladeDivergence from sister species5-7Phylogenetic analyses

When analyzing the tempo of evolution in different species of Eumops, the heterogeneous taxonomic resolution of MT-CYB must be considered, as evolutionary rates may vary across the genus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.