Recombinant European mountain ash ringspot-associated virus Envelope glycoprotein

Shipped with Ice Packs
In Stock

Description

Introduction to European Mountain Ash Ringspot-Associated Virus (EMARaV)

The European mountain ash ringspot-associated virus (EMARaV) is a plant-pathogenic virus that affects the Sorbus aucuparia L., commonly known as the European mountain ash or rowan tree . EMARaV is associated with the ringspot disease observed on these trees . Symptoms of EMARaV include chlorotic ringspots and mottling on the leaves . EMARaV is a segmented, negative-sense RNA virus, and is the type member of the Emaravirus genus . It is not mechanically transmitted, and the specific vector is currently unknown .

Genomic Structure and Proteins of EMARaV

The EMARaV genome comprises four RNA molecules . These RNAs encode several proteins. RNA1 encodes a protein with similarities to the RNA-dependent RNA polymerase of the Bunyaviridae family . RNA2 encodes a protein with a molecular weight of 75 kDa, which contains a conserved motif found in the glycoprotein precursor of the Phlebovirus genus . RNA3 encodes a 35 kDa protein that shares similarities with the putative nucleocapsid protein of unclassified plant viruses . RNA4 encodes a 27 kDa protein with no significant homology to any known protein .

Recombinant Envelope Glycoprotein

The envelope glycoprotein, encoded by RNA2, is crucial for viral entry and interactions with the host . The glycoprotein precursor is processed into subunits . Glycosylation, the addition of carbohydrate moieties, is important for the correct folding and transport of viral envelope glycoproteins .

Detection and Distribution

EMARaV can be detected using reverse transcription-PCR (RT-PCR) with virus-specific primers . The virus has been identified in various European countries, including Germany, Finland, Norway, Sweden, Scotland and Russia .

Table 1 lists EMARaV variants and their locations:

Table 1. EMARaV Variants and Locations

EMARaV VariantsLocation of Sampled RowansRNA3RNA4
Sweden (S)E51605 LuleaHG799707HG799749
E51586 PiteaHG799704HG799746
E51587 PiteaHG799705HG799747
E51594 ÖrnsköldsvikHG799706HG799748
E53016 SkärsaHG799711HG799753
E53011 ÖstaHG799710HG799752
E53009 HebyHG799709HG799751
E52165 Stockholm, VasaHG799708HG799750
Finland (FIN)E51607 RovaniemiHG799712HG799754
E52278 RovaniemiHG799713HG799755
E52279 RovaniemiHG799714HG799756
E52280 RovaniemiHG799715HG799757
Scotland (GB)E52284 Ullapool HillHG799717HG799759
E52286 Ullapool HillHG799718HG799760
E52287 CorrieshallochHG799719HG799761
E52283 DunveganHG799716HG799758
E52288 KinlochlevenHG799720HG799762
Germany (D)E52895 BenzHG799732HG799774
E52991 HamburgHG799739HG799781
E52992 HamburgHG799740HG799782
E52993 HamburgHG799741HG799783
E52994 HamburgHG799742HG799784
E52995 HamburgHG799743HG799785
E52996 HamburgHG799744HG799786
E52997 HamburgHG799745HG799787
E51609 BerlinHG799730HG799772
E52897 BerlinHG799733HG799775
E52900 BerlinHG799734HG799776
E52901 BerlinHG799735HG799777
E52905 BerlinHG799736HG799778
E52907 BerlinHG799737HG799779
E52990 BerlinHG799738HG799780
E52293 FichtelgebirgeHG799731HG799773
Norway (N)E53111 Mo i RanaHG799721HG799763
E53112 Mo i RanaHG799722HG799764
E53113 Mo i RanaHG799723HG799765
E53114 Mo i RanaHG799724HG799766
E53116 MosjoenHG799725HG799767
E53117 MosjoenHG799726HG799768
E53118 FormofossenHG799727HG799769
E53119 FormofossenHG799728HG799770
E53120 SkatvalHG799729HG799771

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Envelope glycoprotein; GP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
198-646
Protein Length
Full Length of Mature Protein
Species
European mountain ash ringspot-associated virus (isolate Sorbus aucuparia) (EMARAV)
Target Protein Sequence
DDNVYNYYEHGDLTEIQLLDKEHYSQDFVSDGFLYNFYVENSHLIYDISNISTITRPVKH NEVTSTWSCDGSSGCYKDHVGKYNKKPDYVLKKVHDGFSCFFTTATICGTCKSEHIAIGD HVRVINVKPYIHIVVKTANKTDKIVIDEFNKFIHEPYYIKPITQIHIDQHDFLVTGSKVY QGTFCERPSKSCFGPNYITSDKTVTLHEPKIRDTFTHDREYIIDYCDYPSNSDLESLELT DMVHHSDKIYSPYDFGLISIGIPKLGYLAGGFCESLVSVKKIEVYGCYDCQNGVKISVTY ESSDSCHTLICKHDSTTHRYFVQQHTTTLNFHSFMSKKDTIIECNQMRKALNLDESSETS VYFESNGVKGSAKEPVNFDFIKNLLYIDYKKIIFVFLVAIISIGIFLRSPYMLLSSILKF RKRRKVVATNRSEQLVMDDDVDVFIGPPS
Uniprot No.

Target Background

Function

Glycoproteins G1 and G2, present on the virion surface, interact with each other. They mediate virion attachment to cell receptors and facilitate membrane fusion following virion endocytosis.

Database Links

KEGG: vg:8355988

Subcellular Location
[Glycoprotein G2]: Virion membrane. Host Golgi apparatus membrane; Multi-pass membrane protein.; [Glycoprotein G1]: Virion membrane. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

FAQs on Recombinant European Mountain Ash Ringspot-Associated Virus (EMARaV) Envelope Glycoprotein

Advanced Research Questions

  • How do structural variations in the recombinant glycoprotein affect EMARaV-host interactions?

    • Experimental design:

      • Site-directed mutagenesis: Introduce mutations in hypervariable regions of the glycoprotein gene (e.g., 3' UTR of RNA3 showing up to 31% nucleotide diversity) .

      • Functional assays:

        • Binding assays: Measure affinity for putative host receptors (e.g., leaf cell membrane proteins) using surface plasmon resonance (SPR).

        • Vector transmission studies: Test mutant glycoproteins for interaction with Phytoptus pyri mite proteins via co-immunoprecipitation .

    • Data contradiction resolution: Discrepancies in transmission efficiency may arise from glycan heterogeneity; use deglycosylation enzymes (e.g., PNGase F) to isolate structural effects .

  • What bioinformatics tools are critical for predicting antigenic epitopes in the recombinant glycoprotein?

    • Pipeline:

      1. Sequence alignment: Compare EMARaV glycoprotein variants (e.g., 94–99% identity in RNA3 UTR) to identify conserved domains.

      2. Epitope prediction: Use tools like ElliPro or BepiPred to map linear and conformational epitopes.

      3. Cross-reactivity analysis: Screen predicted epitopes against plant and mite proteomes to exclude false positives .

    • Validation: ELISA with antisera from infected plants or mites .

Data Analysis & Technical Challenges

  • How to resolve false negatives in EMARaV glycoprotein detection during latent infections?

    • Strategy:

      • Multi-target RT-PCR: Amplify both glycoprotein (RNA2) and nucleocapsid (RNA3) genes to increase sensitivity .

      • Quantitative PCR: Use SYBR Green assays with primers targeting the glycoprotein’s conserved N-terminal region (e.g., 97–99% identity in NP gene) .

    • Troubleshooting: Low viral titers in asymptomatic leaves require nested PCR or immune-capture prior to RNA extraction .

  • What metrics define the success of recombinant glycoprotein purification for antibody production?

    • Quality control parameters:

      ParameterTargetMethod
      Purity>95%SDS-PAGE/Coomassie staining
      Endotoxin<1 EU/mgLimulus amebocyte lysate assay
      AntigenicityStrong signal at ~55 kDa (predicted size)Western blot with EMARaV-positive plant sera .

Ethical & Ecological Considerations

  • How to mitigate risks of EMARaV recombination during glycoprotein expression in heterologous systems?

    • Containment protocols:

      • Use disabled vectors (e.g., non-replicative baculovirus) in BSL-2 facilities.

      • Conduct recombination risk assessments via deep sequencing of expression constructs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.