Recombinant Exeristes roborator Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Exeristes roborator (Parasitoid wasp)
Target Names
COII
Target Protein Sequence
MSTWSMMNLQDANSPMMEQLIFFHDHTLMILLLITITIIYIISSIIMNNLTNKFIMQNQT IEIIWTIIPMIILIYMAIPSLKILYLNDEINNPLMTIKSIGHQWYWSYEYSDFKNIDFNS FMINSKNLNHFRLLDVDNRMIIPMNNQIRMLINSADVIHSWTVPSLGVKIDSVPGRINQT LMMINRPGIYFGQCSEICGMNHSFMPIVIESTSNNNFISWLKSL
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COII) is a crucial component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, encompassing Complexes I-IV and succinate dehydrogenase (Complex II), facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. COII plays a vital role within Complex IV, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) and heme a to the binuclear center (BNC) in subunit 1 (comprising heme a3 and copper B, CuB). The BNC utilizes these electrons and protons from the matrix to reduce oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental methods are most effective for characterizing recombinant E. roborator COII function?

For comprehensive functional characterization, researchers should employ multiple complementary approaches:

Analytical ApproachSpecific TechniqueInformation Obtained
Enzymatic ActivityPolarographic oxygen consumptionElectron transfer rates
Cytochrome c oxidation assaysSubstrate kinetics
Spectroscopic AnalysisElectron paramagnetic resonance (EPR)CuA center structure and oxidation state
UV-visible spectroscopyHeme and copper center integrity
Structural StudiesCircular dichroismSecondary structure content
Crystallography/Cryo-EMThree-dimensional structure
Membrane IntegrationReconstitution into liposomesActivity in membrane environment
Nanodisc incorporationNative-like environment studies

When characterizing the function of E. roborator COII, researchers should consider:

  • Comparison with cytochrome c oxidase activity from model organisms like human COX

  • The necessity of appropriate electron donors (cytochrome c) and acceptors (oxygen)

  • Proper reconstitution of the membrane environment to maintain native-like activity

  • Integration of biochemical data with structural information to correlate structure-function relationships

  • How can researchers study interactions between E. roborator COII and other components of the respiratory chain?

Studying protein-protein interactions requires multiple methodological approaches:

  • Co-immunoprecipitation studies:

    • Using antibodies against tags (His, GST) to pull down complexes

    • Western blot analysis to identify interacting partners

    • Mass spectrometry to identify unexpected interaction partners

  • Biophysical interaction analysis:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Microscale thermophoresis to detect interactions in solution

  • Functional coupling experiments:

    • Reconstitution of partial or complete electron transport chain components

    • Measurement of electron transfer rates between purified components

    • Activity assays in the presence or absence of potential interacting partners

A systematic workflow should progress from identification of interactions to characterization of their functional significance within the electron transport chain.

  • What are the challenges in expressing functional E. roborator COII and how can they be overcome?

ChallengeMethodological SolutionResearch Finding
Membrane protein solubilityOptimization of detergent selectionNon-ionic detergents (DDM, LMNG) typically preserve activity
Cofactor incorporationSupplementation with copper during expressionEnsures proper formation of the CuA center
Proper foldingLower expression temperature (16-20°C)Reduces inclusion body formation
Functional assessmentIntegration into artificial membrane systemsLiposomes provide native-like environment for activity
Species-specific issuesCodon optimization for expression hostImproves translation efficiency

Research observations from similar proteins indicate:

  • Expression in E. coli systems requires careful optimization of induction conditions

  • The addition of specific lipids can enhance stability and activity

  • Co-expression with chaperones may improve folding efficiency

  • Fusion with solubility-enhancing tags (MBP, SUMO) can increase soluble yields

  • Cell-free expression systems may offer advantages for difficult membrane proteins

  • How do mutations in COII affect electron transport function, and what methodologies best assess these effects?

Studies of mutations in cytochrome c oxidase subunits provide valuable insights:

  • Site-directed mutagenesis approaches:

    • Targeting conserved residues in the CuA center

    • Modifying residues at subunit interfaces

    • Creating disease-mimicking mutations based on human COII pathologies

  • Functional analysis methodologies:

    • Oxygen consumption measurements using oxygen electrodes

    • Spectrophotometric monitoring of cytochrome c oxidation rates

    • EPR spectroscopy to assess changes in copper center structure

A missense mutation study in human COII demonstrated that a single amino acid change (T→A transversion) resulted in:

  • Dramatic decrease in cytochrome c oxidase activity

  • Altered stability of multiple subunits of the complex

  • Disruption of heme binding in the associated COX I subunit

This suggests that homologous residues in E. roborator COII likely play similar critical roles in complex assembly and function.

  • What comparative insights can be gained by studying E. roborator COII versus COII from model organisms?

Comparative analysis provides several research advantages:

Comparative AspectMethodological ApproachResearch Application
Sequence conservationMultiple sequence alignmentIdentification of functionally critical residues
Structural differencesHomology modeling against known structuresPrediction of species-specific functional adaptations
Evolutionary relationshipsPhylogenetic analysisUnderstanding parasitoid wasp evolution
Functional conservationHeterologous expression and activity assaysDetermining universality of electron transport mechanisms

Recent comparative studies have shown:

  • E. roborator has undergone a host shift to parasitize rose galls, potentially reflecting adaptive changes

  • The increasing presence of E. roborator in northern regions may correlate with climate change factors

  • Population studies in the Carpathian Basin show increasing numbers in higher elevation regions

These ecological observations provide context for understanding potential functional adaptations in mitochondrial proteins like COII.

  • What approaches are most effective for studying the assembly of functional cytochrome c oxidase complex containing E. roborator COII?

Assembly of the complete cytochrome c oxidase complex involves:

  • Co-expression strategies:

    • Simultaneous expression of multiple subunits in appropriate stoichiometry

    • Use of polycistronic constructs to ensure coordinated expression

    • Selection of expression systems capable of producing multiple membrane proteins

  • Assembly monitoring techniques:

    • Blue native PAGE to visualize intact complexes

    • Activity assays at different stages of assembly

    • Time-resolved structural studies to capture assembly intermediates

  • Assembly factor requirements:

    • Identification of chaperones needed for proper folding

    • Incorporation of heme and copper cofactors

    • Membrane insertion and topology establishment

Studies of cytochrome c oxidase assembly in model organisms reveal:

  • Assembly occurs in a sequential, ordered process

  • Specific chaperones are required for membrane insertion and cofactor addition

  • Mitochondrially encoded subunits (including COII) form the initial assembly nucleus

  • Nuclear-encoded subunits are added in later assembly steps

These principles likely apply to E. roborator COII, though species-specific factors may influence the process.

  • How can researchers leverage E. roborator COII as a model system for understanding parasitoid wasp biology and evolution?

E. roborator COII offers unique research opportunities:

  • Molecular evolutionary studies:

    • Comparison with COII sequences from other parasitoid wasps

    • Analysis of selection pressures on mitochondrial genes

    • Correlation of COII evolution with host range changes

  • Host adaptation research:

    • Analysis of COII variations across populations with different host preferences

    • Correlation of mitochondrial function with parasitoid fitness on different hosts

    • Investigation of energetic requirements for different parasitization strategies

  • Ecological research applications:

    • Using COII as a marker for population studies

    • Tracking host shifts and range expansions

    • Understanding the metabolic basis of host specificity

Recent research has documented:

  • E. roborator appeared in rose gall communities in the eastern Carpathian Basin after 2010, where it was previously absent

  • The species shows differential presence in different rose gall species (Diplolepis rosae versus D. mayri)

  • A correlation between elevation and E. roborator numbers, with higher numbers found in mountain and hilly regions

These ecological observations provide valuable context for laboratory studies of E. roborator COII function and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.