Recombinant Exiguobacterium sibiricum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Exig_2680; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
atpF
Target Protein Sequence
MNLTYRAAEGVAESNHLLLANMIVTIVVFLLLLILLKKFAWGPLVNMMKAREEHVASEIN SAEKSRKDAEVYVEQQQAELNKARTEARDLLEASRRQAEAEQARAMEQARVETELSKEEA RRAIERERAEAQAALKNDVALQAIAAARHVMKTQLATDEAAQRALVDQFLADTKGTN
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and part of the peripheral stalk, linking F(1) and F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Exiguobacterium sibiricum and why is it significant for protein expression studies?

Exiguobacterium sibiricum is a gram-positive, facultatively anaerobic bacterium first isolated from Siberian permafrost. The organism has gained attention for its unique adaptations to extreme environments. The draft genome of E. sibiricum has been sequenced and is approximately 2.8 Mb in length with an average G+C content of 48 mol% . Its genomic features include approximately 2,880 protein-coding genes, making it a valuable model for studying protein expression in extremophiles . The significance for recombinant protein expression lies in understanding how this organism's proteins are adapted to function under extreme conditions.

What are the known characteristics of E. sibiricum proteins that might influence recombinant expression?

Based on the available search results, E. sibiricum contains diverse enzymes with unique characteristics. For example, the GtfC enzyme represents a novel glycoside hydrolase 70 subfamily with 4,6-α-glucanotransferase activity . This enzyme displays a unique domain organization that differs from related enzymes, lacking domain V and having a different order of domains compared to other GH70 family enzymes . This structural diversity suggests that recombinant expression of E. sibiricum proteins, including ATP synthase components, may require careful consideration of their unique structural and functional properties.

What expression systems are optimal for producing recombinant E. sibiricum atpF protein?

While the search results don't specifically address the expression of E. sibiricum atpF, they do provide insights into recombinant expression methodologies. For example, research on E. sibiricum GtfC utilized recombinant expression and purification techniques to characterize its enzymatic properties . For ATP synthase components from extremophiles, E. coli-based expression systems are commonly employed with modifications to account for the differences in codon usage and protein folding requirements. Researchers should consider using expression vectors with controllable promoters (like pET systems) and test multiple E. coli strains (such as BL21(DE3), Rosetta, or Arctic Express) to optimize for the psychrophilic nature of E. sibiricum proteins.

How can structural analysis techniques be applied to study recombinant E. sibiricum atpF protein?

The structural analysis of E. sibiricum GtfC enzyme provides a methodological framework applicable to atpF protein studies. The GtfC was characterized through comparative sequence analysis, domain organization studies, and functional enzymatic assays . For atpF, similar approaches would include:

  • Comparative sequence analysis with atpF from related organisms

  • Domain prediction and structural modeling

  • Functional reconstitution assays

  • Biophysical characterization (circular dichroism, thermal stability assays)

  • X-ray crystallography or cryo-EM for detailed structural analysis

The unique domain organization observed in GtfC suggests that E. sibiricum proteins may have structural adaptations that differ from mesophilic counterparts .

What specific adaptations might be present in E. sibiricum atpF compared to mesophilic homologs?

Based on understanding of psychrophilic adaptations in other extremophiles, E. sibiricum atpF likely contains specific adaptations that permit functionality at low temperatures. These may include:

  • Increased flexibility through reduced proline content in loop regions

  • Modified hydrophobic core packing

  • Altered surface charge distribution

  • Reduced number of salt bridges and hydrogen bonds

While not directly addressing atpF, the analysis of E. sibiricum GtfC revealed evolutionary adaptations that position it structurally between the α-amylase and glucansucrase enzymes , suggesting that E. sibiricum proteins may display unique evolutionary adaptations.

What purification strategies are effective for recombinant E. sibiricum atpF protein?

Based on the purification methodologies used for other E. sibiricum proteins, an effective strategy would include:

  • Affinity chromatography using His-tag or other fusion tags

  • Temperature-controlled purification steps (maintaining lower temperatures)

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography as a final polishing step

In the case of GtfC enzyme, researchers successfully purified the recombinant protein and assessed its activity at various temperatures and pH conditions . The protein showed optimal activity at pH 6.0 and 40°C with a specific activity of 2.2 ± 0.1 U/mg . Similar methodological approaches could be applied to atpF purification, with adjustments for the specific characteristics of membrane proteins.

How can the functional activity of recombinant E. sibiricum atpF be assessed?

Functional assessment of recombinant atpF would require:

  • Reconstitution into liposomes or nanodiscs to recreate a membrane environment

  • ATP synthesis/hydrolysis assays under varying temperature and pH conditions

  • Proton translocation measurements

  • Interaction studies with other ATP synthase subunits

The methodology used to assess GtfC activity, including substrate specificity testing and product analysis , provides a framework for developing functional assays for atpF. Researchers utilized techniques like TLC (thin-layer chromatography) and 1H NMR analysis to characterize the enzyme's products , which suggests that spectroscopic methods could be valuable for studying atpF functionality.

What cloning strategies are recommended for E. sibiricum atpF expression?

For successful cloning and expression of E. sibiricum atpF, researchers should consider:

  • Codon optimization for the expression host

  • Inclusion of appropriate tags for purification and detection

  • Use of PCR amplification with specific primers designed based on the E. sibiricum genome sequence

The search results describe a cloning methodology where "PCR product of each ORF was cloned into the multiple cloning sites of the pUC19 vector" and transformants were "selected by blue-white screening with Luria-Bertani agar plates supplemented with 100 mg/liter ampicillin" . This approach could be adapted for atpF cloning, with modifications specific to the size and characteristics of the atpF gene.

How does E. sibiricum atpF compare to homologs in other extremophiles?

While specific comparative data for atpF is not available in the search results, the phylogenetic analysis of E. sibiricum and related species provides context. The search results indicate that "GtfC homologs present in Exiguobacterium and Bacillus strains form a separate branch closely related to GtfB-like 4,6-α-glucanotransferases and clearly positioned between the GH70 and GH13 family proteins" , suggesting that E. sibiricum proteins may occupy unique evolutionary positions. For atpF, researchers should compare sequences across the Exiguobacterium genus and with other extremophiles to identify conserved and divergent regions.

What insights can plasmid analysis in Exiguobacterium provide for recombinant expression studies?

The search results describe the identification of multiple plasmids in an Exiguobacterium species, with detailed analysis of plasmid pMC1 revealing a size of 71,276 bp containing 66 predicted ORFs . The G+C content of this plasmid (41.75%) was lower than that of the chromosome (48%) . This plasmid analysis methodology demonstrates:

  • The importance of examining native plasmids when developing expression systems

  • The potential for utilizing endogenous plasmids for recombinant expression

  • Considerations for G+C content in designing expression constructs

The table below summarizes the characteristics of plasmids identified in Exiguobacterium sp.:

CharacteristicpMC1pMC2pMC3pMC4pMC5
Size (bp)71,27619,9814,4451,8131,742
GC content (%)41.7541.2442.1442.2542.77
No. of ORFs6622122
Predicted replication genes01011
Predicted transposase genes31000
Predicted resistance genes71000

This information provides valuable context for developing recombinant expression strategies using Exiguobacterium-derived vectors.

What are common challenges in expressing and purifying recombinant E. sibiricum atpF protein?

Based on general challenges in expressing membrane proteins and specific considerations for psychrophilic proteins, researchers should be prepared to address:

  • Protein folding issues at standard expression temperatures

  • Toxicity to host cells due to membrane insertion

  • Formation of inclusion bodies

  • Low expression yields

  • Protein instability during purification

The optimization of GtfC expression and purification, which achieved specific activity levels comparable to related enzymes (2.2 ± 0.1 U/mg) , suggests that careful optimization of expression conditions can overcome these challenges.

How can researchers optimize buffer conditions for maintaining recombinant E. sibiricum atpF stability?

The characterization of GtfC enzyme revealed optimal activity in 25 mM sodium acetate buffer, pH 6.0, containing 1 mM CaCl₂ at 40°C . Similarly, for atpF protein, researchers should systematically test:

  • Buffer types (phosphate, HEPES, Tris, acetate)

  • pH range (5.0-8.0)

  • Salt concentrations (50-500 mM)

  • Divalent cation requirements (Mg²⁺, Ca²⁺)

  • Stabilizing additives (glycerol, detergents for membrane proteins)

  • Temperature effects (4-40°C)

Additionally, the inclusion of appropriate detergents or lipids would be crucial for maintaining the stability of membrane proteins like atpF.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.