Recombinant Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant EcfT is a full-length transmembrane protein (263 amino acids; UniProt ID: B1YH82) expressed in E. coli for biochemical and structural studies . It belongs to the energy-coupling factor (ECF) transporter family, which facilitates vitamin uptake in Gram-positive bacteria . The recombinant protein is purified to >90% purity via SDS-PAGE and stored in Tris/PBS-based buffer with 6% trehalose .

Key Features

  • Source Organism: Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) .

  • Tag: N-terminal His tag for affinity purification .

Functional Role in ECF Transporters

ECF transporters mediate vitamin uptake (e.g., folate, riboflavin) through a unique toppling mechanism :

  1. Substrate Binding: The S-component binds extracellular vitamins.

  2. Module Association: EcfT anchors the S-component to the ECF module.

  3. ATP-Driven Transport: ATP hydrolysis by EcfA/A’ induces conformational shifts in EcfT, releasing the substrate intracellularly .

Mechanistic Insights from Simulations
Coarse-grained molecular dynamics studies on homologous systems (e.g., Lactobacillus delbrueckii ECF-FolT2) reveal that EcfT’s hydrophobic pockets (e.g., P2, P9) are critical for inhibitor binding, suggesting potential allosteric modulation sites .

Drug Discovery

  • Inhibitor Screening: EcfT is a target for antimicrobials due to its absence in humans. Inhibitors like compound 1G = −11.6 kJ/mol) bind EcfT’s P9 pocket, disrupting vitamin uptake .

  • Structural Studies: Recombinant EcfT enables crystallography and mutagenesis to map transport mechanisms .

Biotechnological Relevance

  • Thermostability: Exiguobacterium sibiricum’s cold adaptation (growth range: −5°C to 39°C) makes EcfT a model for studying protein stability in extremophiles .

Potential Applications

  • Antimicrobial Development: Targeting ECF transporters could reduce bacterial viability without affecting human cells .

  • Agricultural Bioinoculants: E. sibiricum’s plant growth-promoting traits may leverage EcfT in nutrient uptake engineering.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; Exig_0127; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
ecfT
Target Protein Sequence
MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIR YVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSIT TLVTLTTSPIELTDAIELLLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKIMKAQQA RGVDLSAGPIKERLRAIIPLLIPLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTT RDTGLILLLVALGLLLVYLRGGF
Uniprot No.

Target Background

Function
The transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy needed for the transport of various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Exiguobacterium sibiricum Energy-coupling factor transporter transmembrane protein EcfT?

The Energy-coupling factor transporter transmembrane protein EcfT (short name: ECF transporter T component EcfT) is a membrane protein encoded by the ecfT gene (locus Exig_0127) in Exiguobacterium sibiricum strain DSM 17290/JCM 13490/255-15. It functions as a critical component of the Energy-coupling factor (ECF) transport system, which is responsible for the uptake of various micronutrients in bacteria . The full-length protein consists of 263 amino acids with a characteristic transmembrane domain architecture that facilitates its function in nutrient transport across the cell membrane .

How does Exiguobacterium sibiricum EcfT compare to other transmembrane proteins in related bacterial species?

Exiguobacterium sibiricum 255-15 was originally isolated from Siberian permafrost and exhibits remarkable xerotolerance (resistance to desiccation) . The EcfT protein likely contributes to this adaptation by maintaining membrane integrity and cellular homeostasis during desiccation stress. When comparing the protein with homologs from other extremophiles, researchers should note that E. sibiricum shares physiological properties with both cold-adapted and xerotolerant organisms. The amino acid sequence of EcfT (MIVGQHIPGTSYLHRSSAVAKIIFAFCFIPLVFLANNAATNIFLLLFTFFALASSKLPIRYVLKGLRPILFLIIFTFIIQLLFTREGAVLFEFGWFKIYEEGLRLAIIVSLRFFYLVSITTLVTLTTSPIELDAIELLKPFKVVRVPTHEIALMLSISLRFLPTLAEETEKMKAQQARGVDLSAGPIKERLRAIIPLIPLLFISAFKRAEDLATAMEARGYRGGEGRTRLRESKWTTRDTGLILLLVALGLLLVYLRGGF) contains regions typical of transmembrane helices and characteristic motifs of ECF transporters .

What are the optimal conditions for expressing recombinant Exiguobacterium sibiricum EcfT protein?

For optimal expression of recombinant EcfT protein, researchers should consider the following methodological approach:

  • Expression System Selection: Given the transmembrane nature of EcfT, membrane protein expression systems such as E. coli C41(DE3) or C43(DE3) strains are recommended as they are engineered for toxic membrane protein expression.

  • Temperature Optimization: Expression at lower temperatures (15-25°C) often enhances proper folding of membrane proteins.

  • Induction Parameters: Use moderate inducer concentrations to prevent formation of inclusion bodies.

  • Buffer Composition: During purification, maintain the protein in a buffer containing:

    • 50 mM Tris-HCl (pH 7.5-8.0)

    • 150-300 mM NaCl

    • 5-10% glycerol

    • Appropriate detergent (e.g., DDM, LDAO, or Triton X-100)

When designing your expression experiments, use a systematic approach similar to true experimental design with proper controls to identify optimal conditions .

How can researchers effectively isolate and purify functional EcfT protein?

Purification of membrane proteins like EcfT requires special consideration:

Detailed Purification Protocol:

  • Cell Lysis: Use gentle methods such as enzymatic lysis or moderate sonication in buffer containing protease inhibitors.

  • Membrane Fraction Isolation: Separate membrane fractions using ultracentrifugation (typically 100,000 × g for 1 hour).

  • Solubilization: Carefully solubilize membrane proteins using appropriate detergents:

    DetergentConcentration RangeAdvantagesLimitations
    DDM0.5-1%Mild, maintains functionExpensive
    LDAO0.5-2%Effective solubilizationMay destabilize some proteins
    Triton X-1000.5-1%Cost-effectiveDifficult to remove
  • Affinity Chromatography: Use appropriate affinity tags (His, FLAG, etc.) followed by size exclusion chromatography.

  • Quality Control: Verify protein purity by SDS-PAGE and functionality through activity assays.

The final storage buffer should contain 50% glycerol for stability, as indicated for the commercially available recombinant protein .

How might EcfT contribute to the xerotolerance mechanisms in Exiguobacterium sibiricum?

Exiguobacterium sibiricum 255-15 and related strain Helios demonstrate remarkable xerotolerance, even exceeding that of the reference xerotolerant model strain Deinococcus radiodurans . The EcfT protein may contribute to this desiccation resistance through several mechanisms:

  • Membrane Stabilization: As a transmembrane protein, EcfT may help maintain membrane integrity during desiccation.

  • Nutrient Transport Regulation: During desiccation stress, controlled transport of essential nutrients becomes critical for survival.

  • Stress Response Coupling: EcfT may couple energy-dependent processes to stress response mechanisms.

Researchers investigating this relationship should employ comparative proteomics between hydrated and desiccated cells, focusing on changes in EcfT expression, localization, and post-translational modifications. Significant changes observed in cell morphology after desiccation suggest that cellular surface structure plays an important role in xerotolerance .

What techniques are most appropriate for studying EcfT structure-function relationships?

To elucidate structure-function relationships of EcfT:

  • Site-Directed Mutagenesis: Systematic mutation of conserved residues can identify those critical for function.

  • Chimeric Protein Construction: Creating chimeric proteins between EcfT and related transporters can help identify functional domains.

  • Structural Analysis Methods:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR for specific domains

    • Molecular dynamics simulations

  • Functional Assays:

    • Transport assays using radioactively labeled substrates

    • Fluorescence-based transport assays

    • Growth complementation in transporter-deficient strains

Creating genetic modification systems is now feasible, as demonstrated by the successful transformation of Exiguobacterium sp. Helios using the Lactobacillus plasmid pRCR12 . This represents the first successful genetic modification in the Exiguobacterium genus and opens new avenues for EcfT research.

How does the ecfT gene compare across different Exiguobacterium species and what evolutionary insights can be gained?

The Exiguobacterium genus shows remarkable diversity, with species isolated from environments ranging from Siberian permafrost to solar panels . Researchers investigating evolutionary aspects of EcfT should:

Recent genomic analyses have revealed that both E. sibiricum 255-15 and Exiguobacterium sp. Helios contain complete sets of competence-related DNA transformation genes, suggesting natural competence capabilities . This genomic feature could be exploited for developing more efficient transformation protocols for genetic studies of EcfT.

What is the relationship between EcfT and other transport systems in Exiguobacterium sibiricum 255-15?

Exiguobacterium sibiricum 255-15 possesses multiple transport systems adapted to its extreme environment. Researchers should:

  • Conduct Comparative Proteomics: Compare expression patterns of different transporters under varying conditions.

  • Perform Co-expression Analysis: Identify genes co-expressed with ecfT to discover functional relationships.

  • Analyze Transportomes: Compare the complete set of transporters (transportome) in E. sibiricum with other extremophiles.

  • Functional Redundancy Tests: Investigate whether other transporters can compensate for EcfT dysfunction.

What are the most common challenges when working with recombinant EcfT and how can they be addressed?

Researchers often encounter several challenges when working with membrane proteins like EcfT:

  • Low Expression Levels:

    • Solution: Optimize codon usage for expression host

    • Use strong, inducible promoters

    • Consider fusion tags that enhance expression

  • Protein Insolubility:

    • Solution: Screen multiple detergents and concentrations

    • Try amphipols or nanodiscs for stabilization

    • Consider expression as fragments for structural studies

  • Loss of Function During Purification:

    • Solution: Ensure gentle purification conditions

    • Maintain appropriate detergent concentrations throughout

    • Include stabilizing ligands or cofactors

  • Aggregation During Storage:

    • Solution: Store in 50% glycerol as indicated for commercial preparations

    • Avoid freeze-thaw cycles

    • Consider flash-freezing small aliquots

How can researchers verify that recombinant EcfT is correctly folded and functional?

Verification of proper folding and functionality is crucial for membrane proteins:

  • Circular Dichroism (CD) Spectroscopy: Assess secondary structure content.

  • Thermal Shift Assays: Evaluate protein stability in different buffer conditions.

  • Limited Proteolysis: Properly folded proteins often show distinct proteolytic patterns.

  • Functional Assays:

    • ATPase activity measurements if applicable

    • Substrate binding assays

    • Reconstitution into liposomes to test transport function

  • Structural Homogeneity: Use size exclusion chromatography and dynamic light scattering to assess monodispersity.

What are promising applications of Exiguobacterium sibiricum EcfT in biotechnology and synthetic biology?

Considering the extremophilic nature of Exiguobacterium sibiricum, its EcfT protein holds several promising applications:

  • Biosensor Development: EcfT could be engineered as part of biosensors for specific nutrients or environmental conditions.

  • Membrane Protein Engineering Platform: The xerotolerance properties make it a candidate for engineering stable membrane proteins.

  • Synthetic Cell Transport Systems: EcfT could be incorporated into synthetic cells requiring controlled transport across membranes.

  • Bioremediation Applications: The ability of Exiguobacterium sp. to produce selenium nanoparticles suggests potential applications in bioremediation, possibly involving nutrient transport systems.

How might new technologies advance our understanding of EcfT structure and function?

Emerging technologies that could accelerate EcfT research include:

  • AlphaFold and Other AI-Based Structure Prediction: These tools can provide structural insights even without experimental structures.

  • Single-Molecule Imaging Techniques: To visualize transport processes in real-time.

  • Nanobody Development: For stabilization during structural studies or as tools for functional assays.

  • Microfluidics: For high-throughput screening of conditions affecting EcfT function.

  • CRISPR-Cas9 Engineering: Now that genetic modification has been demonstrated in Exiguobacterium , CRISPR-based approaches could enable precise genetic manipulation of ecfT.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.