Recombinant Exiguobacterium sibiricum Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

PlsY catalyzes the transfer of an acyl group from acyl-phosphate to glycerol 3-phosphate, initiating phosphatidic acid synthesis in bacterial membranes . In Exiguobacterium sibiricum, PlsY is encoded by the plsY gene (UniProt ID: B1YEC6) and expressed recombinantly in E. coli for biochemical studies . Its activity is critical for membrane biogenesis, particularly in extremophilic environments where E. sibiricum thrives .

Functional Insights

  • Substrate specificity: Utilizes acyl-phosphate and glycerol 3-phosphate to produce lysophosphatidic acid .

  • Inhibition: Noncompetitive inhibition by palmitoyl-CoA , suggesting regulatory feedback mechanisms.

  • Thermal adaptation: E. sibiricum PlsY operates across a broad temperature range (-5°C to 39°C) , aligning with the organism’s psychrotrophic nature.

Recombinant Production and Applications

Recombinant PlsY is produced in E. coli with a His-tag for purification . Key applications include:

  • Biochemical studies: Investigating bacterial lipid biosynthesis pathways .

  • Biotechnological potential: Engineering lipid membranes in extremophiles for industrial uses .

  • Structural biology: Resolving membrane protein architectures via crystallography .

Mutagenesis Studies

  • Motif 2 mutations (Gly→Ala): Reduce glycerol 3-phosphate binding affinity (K<sub>m</sub> defect) .

  • Motif 3 mutations (His/Asn/Glu substitutions): Compromise catalytic activity and structural stability .

Environmental Adaptability

PlsY’s role in membrane synthesis supports E. sibiricum’s survival in permafrost, solar panels, and high-salinity environments . The organism’s ability to metabolize diverse carbon sources (e.g., glycerol, starch) further complements lipid biosynthesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Exig_1149; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
plsY
Target Protein Sequence
MIEIIGILILGYLLGSIPFALLVGKWGHGIDIRQHGSGNLGTTNTFRVLGKKAGIIVLIG DLGKGAVASLVPILLASELHPLFAGLAAVVGHIYPVFARFKGGKAVATSGGMLLVTSPIL FLVLLISFLTTLRLSRMVSLSSIVSASIGIVAAITIGIVEQDWIVPTFFTILALFVIFKH RENISRIRQGTESKIGMFAKDKKDTD
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Exiguobacterium sibiricum Glycerol-3-phosphate acyltransferase (plsY) and what is its functional significance?

Exiguobacterium sibiricum Glycerol-3-phosphate acyltransferase (plsY) is a membrane-associated enzyme involved in the initial step of phospholipid biosynthesis. Similar to other bacterial G3PATs, it catalyzes the transfer of an acyl group from acyl-ACP (acyl carrier protein) to the sn-1 position of glycerol-3-phosphate, producing lysophosphatidic acid (LPA). This reaction represents the first committed step in membrane phospholipid biosynthesis in bacteria.

E. sibiricum is a gram-positive bacterium notable for its adaptation to cold environments, suggesting that its plsY enzyme may possess unique properties related to maintaining membrane fluidity at low temperatures. The functional significance of this enzyme extends beyond basic metabolism to potential roles in bacterial cold adaptation, similar to how plant G3PATs with higher selectivity for unsaturated acyl-substrates contribute to chilling tolerance .

How does the structure of E. sibiricum plsY compare with G3PATs from other organisms?

Unlike the soluble G3PATs found in plant chloroplasts, E. sibiricum plsY is likely membrane-bound, similar to other bacterial plsY enzymes. While specific structural data for E. sibiricum plsY is limited, comparisons can be drawn with better-characterized G3PATs.

Plant soluble G3PATs exhibit substrate selectivity for acyl-ACP over acyl-CoA and show varying preferences for saturated versus unsaturated fatty acids . The squash (Cucurbita moschata) G3PAT contains critical amino acid residues such as E142, K193, H194, R235, and R237 that are essential for catalytic activity, as mutations in these residues (E142A, K193S, R235S, and R237S) result in complete enzyme inactivation .

Additionally, specific mutations like L261F in squash G3PAT can significantly alter substrate selectivity by increasing the Km for unsaturated acyl-substrates . Similar structure-function relationships may exist in E. sibiricum plsY, though the specific residues would likely differ based on evolutionary divergence.

What expression systems are most suitable for producing recombinant E. sibiricum plsY?

Based on successful expression of other bacterial proteins, several expression systems may be suitable for recombinant E. sibiricum plsY:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, well-established protocolsPotential inclusion body formationInduction: 0.1-0.5 mM IPTG, 16-20°C, 12-16 hours
Bacillus subtilisGram-positive host, efficient secretionLower yields than E. coliGrowth at 30°C, controlled pH (7.0-7.5)
Cell-free systemsAvoids toxicity issues, rapid expressionHigher cost, lower yield30°C, 4-6 hours incubation

For membrane-associated proteins like plsY, the E. coli expression system with bactosome formation (enzymes expressed in E. coli bacteria) has proven effective for producing functional enzymes . The CRISPR/Cas9 system established for B. subtilis ATCC 6051a with efficiency of 33% to 53% could potentially be adapted for genetic manipulation of E. sibiricum plsY prior to recombinant expression .

What experimental design approaches are most effective for studying the kinetics of E. sibiricum plsY?

Designing robust experiments for studying E. sibiricum plsY kinetics requires careful consideration of multiple variables. A true experimental design approach with proper controls is essential:

  • Variable identification and control:

    • Independent variables: Substrate concentrations, temperature, pH, ionic strength

    • Dependent variables: Enzyme velocity, product formation

    • Extraneous variables: Enzyme stability, substrate purity, assay component interactions

  • Kinetic measurement protocol:
    For accurate determination of Km and Vmax values, implement a systematic approach:

    • Use substrate concentrations ranging from 0.2×Km to 5×Km

    • Maintain initial velocity conditions (<10% substrate depletion)

    • Include appropriate negative controls (heat-inactivated enzyme)

    • Ensure linearity with respect to time and enzyme concentration

  • Temperature-dependent kinetics:
    Given E. sibiricum's psychrophilic nature, conduct assays at multiple temperatures (4°C, 15°C, 25°C, 37°C) to establish temperature-activity relationships.

  • Data analysis:

    • Use Michaelis-Menten, Lineweaver-Burk, and Eadie-Hofstee plots for comprehensive analysis

    • Apply non-linear regression for direct fitting to Michaelis-Menten equation

    • Calculate catalytic efficiency (kcat/Km) to evaluate substrate preference

When analyzing substrate selectivity, adapt the in vitro assay optimized for plant G3PATs that can distinguish selective and non-selective enzyme forms under physiologically relevant conditions .

How can CRISPR/Cas9 be used to modify the plsY gene in E. sibiricum for functional studies?

The CRISPR/Cas9 system can be adapted for gene editing in E. sibiricum based on successful implementations in other bacteria:

  • CRISPR/Cas9 system construction:
    Develop an all-in-one knockout plasmid containing:

    • Target-specific guide RNA (gRNA) designed to recognize sequences within the plsY gene

    • Cas9 endonuclease gene under a suitable promoter

    • Homologous repair template containing desired modifications flanked by homology arms (500-1000 bp)

  • Guide RNA design strategy:

    • Select target sequences with minimal off-target effects

    • Ensure PAM site (NGG for S. pyogenes Cas9) accessibility

    • Design gRNAs targeting conserved catalytic regions for loss-of-function studies

  • Transformation protocol:
    Given that E. sibiricum, like undomesticated B. subtilis strains, may be poorly transformable:

    • Optimize electroporation conditions (field strength, pulse duration)

    • Consider using transformation-enhancing agents (e.g., glycine, threonine)

    • Use highly concentrated plasmid DNA (>500 ng)

  • Mutation verification:

    • PCR amplification and sequencing of the targeted region

    • Restriction enzyme analysis if the mutation creates/abolishes restriction sites

    • Functional assays to confirm altered enzymatic activity

This approach can achieve mutation efficiencies of 33-53% as demonstrated in B. subtilis ATCC 6051a , enabling the creation of specific point mutations to study structure-function relationships in E. sibiricum plsY.

What methodologies are recommended for analyzing substrate selectivity in E. sibiricum plsY?

To comprehensively characterize substrate selectivity in E. sibiricum plsY, implement the following methodologies:

  • Competitive assay system:
    Develop a competition assay where multiple substrates (e.g., saturated vs. unsaturated acyl-ACPs) are presented simultaneously to determine preferential incorporation.

  • Kinetic analysis of individual substrates:
    Compare kinetic parameters (Km, Vmax, kcat) for different substrates to quantify selectivity:

    SubstrateKm (μM)Vmax (nmol/min/mg)kcat/Km (M⁻¹s⁻¹)
    16:0-ACPxyz
    18:0-ACPx'y'z'
    18:1-ACPx''y''z''

    Note: The actual values would be determined experimentally

  • Site-directed mutagenesis:
    Based on insights from plant G3PATs, create mutations like L261F (which altered substrate selectivity in squash G3PAT) at corresponding positions in E. sibiricum plsY to identify residues determining substrate preference.

  • Low-temperature adaptation studies:
    Examine substrate selectivity at various temperatures (4-37°C) to determine if E. sibiricum plsY exhibits temperature-dependent changes in substrate preference as an adaptation mechanism.

  • Product analysis:
    Use mass spectrometry to characterize the acyl composition of LPA produced under various conditions, providing direct evidence of substrate incorporation patterns.

How should researchers approach contradictory data when studying the catalytic mechanism of E. sibiricum plsY?

When encountering contradictory data in plsY research, follow this systematic approach:

  • Examine the data thoroughly:

    • Identify specific discrepancies and patterns that contradict the initial hypothesis

    • Pay careful attention to outliers that may have influenced results

    • Compare data with existing literature on G3PATs from other organisms

  • Evaluate initial assumptions and research design:

    • Review experimental design for potential confounding variables

    • Assess whether the contradictions arise from methodological issues or represent genuine biological phenomena

    • Consider whether temperature, pH, or other assay conditions might affect enzyme behavior

  • Consider alternative explanations:

    • E. sibiricum's adaptation to cold environments may result in enzyme behavior that differs from mesophilic counterparts

    • Allosteric regulation mechanisms may exist that weren't accounted for in the experimental design

    • Post-translational modifications could affect enzyme activity

  • Refine the experimental approach:

    • Modify data collection processes if methodological issues are identified

    • Implement additional controls to account for unexpected variables

    • Consider testing under different conditions that might reveal the basis for contradictory results

  • Kinetic analysis framework:
    For contradictory kinetic data, implement structural analysis to determine if E. sibiricum plsY exhibits:

    • Substrate inhibition at high concentrations

    • Cooperative binding (sigmoidal kinetics)

    • Multiple activity states depending on environmental conditions

This approach transforms contradictory data from a challenge into an opportunity for deeper mechanistic understanding of E. sibiricum plsY function.

What are the optimal purification strategies for obtaining active recombinant E. sibiricum plsY?

Purifying active recombinant E. sibiricum plsY requires careful consideration of its membrane-associated nature:

  • Solubilization strategies:

    • Test multiple detergents (DDM, LDAO, Triton X-100) at various concentrations

    • Evaluate protein-lipid nanodiscs or amphipols for maintaining native-like environment

    • Consider maltose-neopentyl glycol (MNG) detergents for enhanced stability

  • Affinity tag selection:

    • C-terminal tags are generally preferable to avoid interfering with membrane insertion

    • His6-tag with TALON or Ni-NTA affinity chromatography offers efficient purification

    • Consider TEV protease cleavage sites for tag removal if tag affects activity

  • Purification protocol:

    StageMethodBuffer CompositionCritical Parameters
    Cell lysisSonication or high-pressure homogenization50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsTemperature control (<4°C)
    Membrane isolationUltracentrifugationSame as lysis buffer100,000×g, 1 hour, 4°C
    SolubilizationDetergent treatmentLysis buffer + selected detergent (1-2× CMC)Gentle mixing, 1-2 hours, 4°C
    Affinity purificationIMACAbove + 20-250 mM imidazole gradientFlow rate optimization, column selection
    Size exclusionGel filtration25 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent (0.5× CMC)Resolution of monomeric protein
  • Activity preservation:

    • Include glycerol (10-20%) in all buffers to maintain stability

    • Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation

    • Consider adding phospholipids (0.1-0.5 mg/ml) to stabilize the protein

  • Quality control assessments:

    • SDS-PAGE for purity evaluation

    • Western blot for identity confirmation

    • Circular dichroism to verify proper folding

    • Activity assays to confirm functional state after each purification step

Optimizing these parameters will yield highly pure, active E. sibiricum plsY suitable for structural and functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.