Recombinant Exiguobacterium sibiricum UPF0295 protein Exig_0660 (Exig_0660)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Exig_0660; UPF0295 protein Exig_0660
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
Exig_0660
Target Protein Sequence
MKKQRKNKINRARNLAMFLVFGGMLVMYGGLLLKQFEIIMVILMLVGFVMVLASTALYFL IGLTSTKAAVVTCPNCGKETKVLGRVDLCMHCDEPLTMDRNLEGKEFDEKYNKHSKRAPR
Uniprot No.

Target Background

Database Links
Protein Families
UPF0295 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Exiguobacterium sibiricum UPF0295 protein Exig_0660?

Exig_0660 is a protein encoded by the Exig_0660 gene in Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15). It belongs to the UPF0295 protein family, which consists of proteins with currently unknown function. The full-length protein contains 120 amino acids and is available as a recombinant protein for research purposes. Based on sequence analysis, it appears to have membrane-associated properties, containing potential transmembrane regions .

What is currently known about the structural characteristics of Exig_0660?

The structure of Exig_0660 has been computationally predicted using AlphaFold and is available in the RCSB PDB database (AF_AFB1YK60F1). The model has a global pLDDT (predicted Local Distance Difference Test) confidence score of 81.66, indicating a relatively confident prediction. The structure was released in AlphaFold DB on December 9, 2021, and last modified on September 30, 2022. The model suggests the protein has both structured regions and potentially membrane-associated domains .

What expression systems are recommended for producing functional Exig_0660?

Based on available research data, the following expression systems and conditions are recommended:

ParameterRecommended ApproachNotes
Expression HostE. coliSuccessfully used for expression as indicated in product information
StrainBL21(DE3) or equivalentCommon for recombinant protein expression
Fusion TagN-terminal His tagFacilitates purification and detection
Expression Temperature16-25°CLower temperatures may improve proper folding
MediaRich media (LB, TB)Supports higher biomass and protein yield

The recombinant protein has been successfully expressed in E. coli with yields sufficient for research applications. When expressed with an N-terminal His tag, purification can achieve >90% purity as determined by SDS-PAGE .

What are optimal protocols for reconstituting lyophilized Exig_0660?

For optimal reconstitution of lyophilized Exig_0660, follow this methodological approach:

  • Initial preparation:

    • Briefly centrifuge the vial before opening to collect all material at the bottom

    • Work in a sterile environment to prevent contamination

  • Reconstitution process:

    • Add deionized sterile water to achieve 0.1-1.0 mg/mL concentration

    • Gently rotate or invert the vial until completely dissolved

    • Avoid vortexing to prevent protein denaturation

  • Stabilization and storage:

    • Add glycerol to a final concentration of 5-50% (recommended: 50%)

    • Prepare small working aliquots to avoid freeze-thaw cycles

    • Store reconstituted protein at -20°C/-80°C for long-term storage

    • Keep working aliquots at 4°C for up to one week only

According to product documentation, repeated freezing and thawing is not recommended as it may affect protein stability and activity .

How can researchers validate the AlphaFold-predicted structure experimentally?

To experimentally validate the AlphaFold-predicted structure of Exig_0660 (pLDDT: 81.66), researchers should employ multiple complementary techniques:

  • Spectroscopic methods:

    • Circular dichroism (CD) to confirm secondary structure composition

    • FTIR spectroscopy to analyze secondary structure in membrane environments

    • Fluorescence spectroscopy to probe tertiary structure

  • Biophysical characterization:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to identify domain boundaries and flexible regions

  • Advanced structural techniques:

    • X-ray crystallography, optimizing for membrane protein crystallization conditions

    • NMR spectroscopy for solution structure determination

    • Cryo-EM analysis using appropriate membrane mimetics

  • Cross-validation approaches:

    • Site-directed mutagenesis of predicted structural elements

    • Disulfide cross-linking of residues predicted to be in proximity

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

The AlphaFold model provides a starting point, but experimental validation remains essential for confirming structural details, especially for regions with lower confidence scores .

What computational methods should be employed to predict potential functions of Exig_0660?

For predicting the function of this uncharacterized protein, researchers should implement a multi-faceted computational approach:

  • Sequence-based analysis:

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Multiple sequence alignment with UPF0295 family members

    • Transmembrane topology prediction using TMHMM, TOPCONS, or Phobius

    • Analysis of conserved motifs and potential functional domains

  • Structure-based methods:

    • Structural alignment against known protein structures using DALI or TM-align

    • Binding site prediction using CASTp or COACH

    • Molecular docking with potential ligands based on binding pocket analysis

    • Molecular dynamics simulations to identify stable conformations

  • Genomic context analysis:

    • Examination of neighboring genes in the E. sibiricum genome

    • Comparison with syntenic regions in related Exiguobacterium species

    • Co-expression analysis if transcriptomic data is available

  • Phylogenetic profiling:

    • Correlation of protein presence/absence with specific phenotypes

    • Analysis of evolutionary rate to identify functionally important residues

The combination of these approaches can help generate testable hypotheses about Exig_0660's biological function .

How can Exig_0660 be used to study membrane protein adaptation in extremophiles?

Exiguobacterium sibiricum is known to thrive in extreme environments, making Exig_0660 valuable for studying membrane adaptations in extremophiles:

  • Comparative analysis framework:

    • Identify and compare UPF0295 homologs across extremophilic bacteria from different environments

    • Analyze sequence conservation patterns in transmembrane regions versus soluble domains

    • Identify potential adaptations in membrane-associating residues that correlate with specific extreme conditions

  • Experimental approaches:

    • Express Exig_0660 in mesophilic hosts and assess effects on membrane properties

    • Perform site-directed mutagenesis of predicted adaptation-related residues

    • Measure protein stability and folding under varying conditions (temperature, pH, salt)

    • Analyze lipid interactions using reconstituted systems

  • Structural studies under extreme conditions:

    • Compare protein dynamics at different temperatures using molecular dynamics simulations

    • Analyze conformational flexibility using HDX-MS under varying conditions

    • Determine structure-function relationships in membrane mimetics resembling extremophile membranes

The Exiguobacterium genus has capabilities for growth under suboptimal conditions, and membrane proteins like Exig_0660 may contribute to this environmental adaptability .

What techniques can identify potential interaction partners of Exig_0660?

To identify interaction partners of Exig_0660, researchers should implement a multi-technique approach:

  • Affinity-based methods:

    • Pull-down assays using His-tagged Exig_0660 as bait

    • Co-immunoprecipitation with anti-Exig_0660 antibodies

    • Proximity labeling approaches (BioID, APEX) in native organisms

  • Cross-linking strategies:

    • In vivo chemical cross-linking followed by mass spectrometry identification

    • Site-specific cross-linking at predicted interaction interfaces

    • Cross-linking mass spectrometry (XL-MS) for mapping interaction sites

  • Genetic and genomic approaches:

    • Bacterial two-hybrid screening

    • Suppressor mutation analysis

    • Comparative genomics to identify consistently co-occurring genes

  • Biophysical techniques:

    • Surface plasmon resonance (SPR) with candidate interactors

    • Microscale thermophoresis for quantifying interactions

    • Native mass spectrometry for intact complexes

Given Exig_0660's predicted membrane localization, detergent choice and membrane mimetics are critical considerations when designing interaction studies .

What are common challenges in purifying recombinant Exig_0660 and how can they be addressed?

Researchers commonly encounter several challenges when purifying membrane-associated proteins like Exig_0660:

ChallengePotential SolutionsMonitoring Methods
Low expression levels- Optimize codon usage
- Test different promoters
- Use specialized expression strains
Western blot, SDS-PAGE
Inclusion body formation- Lower induction temperature (16°C)
- Co-express with chaperones
- Use solubility-enhancing fusion tags
Microscopy, SDS-PAGE
Inefficient extraction- Screen multiple detergents (DDM, LDAO)
- Optimize detergent:protein ratio
- Consider native nanodiscs
Western blot, activity assays
Protein aggregation- Add stabilizing agents (glycerol 5-50%)
- Optimize buffer composition
- Maintain consistent temperature
DLS, SEC analysis
Low purity- Implement two-step purification
- Optimize imidazole gradients
- Consider ion exchange chromatography
SDS-PAGE, mass spectrometry

Product information indicates that Exig_0660 has been successfully purified to >90% purity using His-tag affinity chromatography when expressed in E. coli .

How can researchers design targeted functional assays for Exig_0660?

Without established function for UPF0295 family proteins, researchers should design exploratory functional assays:

  • Structural feature-based assays:

    • Test for metal binding capacity based on the CPNCG motif

    • Assess membrane disruption or stabilization properties

    • Investigate potential redox activity due to cysteine residues

  • Phenotypic assays:

    • Create knockout/knockdown strains and assess phenotypic changes

    • Test complementation with Exig_0660 homologs from different species

    • Evaluate impact on membrane integrity under stress conditions

  • Interactome mapping:

    • Identify binding partners through pull-down experiments

    • Assess co-localization with other cellular components

    • Determine if Exig_0660 forms homo-oligomeric structures

  • Evolutionary context-based approaches:

    • Identify enriched functions in organisms containing UPF0295 family proteins

    • Test for roles in specific pathways conserved across these organisms

    • Investigate potential roles in extremophile adaptation

Preliminary data should guide more specific functional characterization, potentially revealing novel biological roles for this uncharacterized protein family .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.