Recombinant Exiguobacterium sibiricum UPF0316 protein Exig_2248 (Exig_2248)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Exig_2248; UPF0316 protein Exig_2248
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
Exig_2248
Target Protein Sequence
MGQILLILLLQLIYVPVLTLRTIMLVKGRTIIAGVLGTVETLIYIFALGIVFRDLTTVGM IVYALGFGLGILIGGFVERKLAIGYNMIQVHTQDFPAELIQVIRDNGFGVTHYQGQGRDG IRYRLDVLAARTRMKVLRNLVEEYEPKAFLVAFDSVDFKGGYMLKGLKRSQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Exiguobacterium sibiricum and why is the Exig_2248 protein significant for research?

Exiguobacterium sibiricum is a gram-positive, non-spore-forming, motile, facultatively anaerobic bacterium belonging to the genus Exiguobacterium, which was first described in 1983 . E. sibiricum is particularly noteworthy for its ability to grow at low temperatures (as low as 4°C) and has been isolated from various environments, including permafrost . The bacterium has occasionally been isolated from human clinical specimens, though its pathogenic potential was poorly understood until recently documented skin infections .

The Exig_2248 protein (UPF0316 family) represents an important research target for several reasons:

  • It belongs to a protein family of unknown function (UPF0316), presenting opportunities for novel functional characterization

  • The protein's presence in a psychrotolerant organism suggests potential cold-adaptation mechanisms

  • Understanding its structure-function relationships may provide insights into E. sibiricum's unique environmental adaptability

  • As a membrane-associated protein (based on its amino acid sequence), it may play roles in cellular interaction with the environment

The investigation of this protein contributes to our foundational knowledge of bacterial adaptation mechanisms and potentially to biotechnological applications utilizing cold-active proteins.

How does the recombinant expression system affect the structural integrity of Exig_2248?

The recombinant expression of Exig_2248 in E. coli with an N-terminal His-tag presents both advantages and challenges for structural studies . When expressed heterologously, several considerations must be addressed:

  • Codon optimization: E. sibiricum and E. coli have different codon usage preferences, potentially affecting translation efficiency and protein folding kinetics

  • Membrane protein expression: As Exig_2248 contains hydrophobic regions, its expression in E. coli may lead to inclusion body formation without proper membrane integration

  • Tag interference: The N-terminal His-tag may influence protein folding or function, particularly if the N-terminus is important for membrane insertion

To assess structural integrity, researchers typically employ multiple complementary techniques:

  • Circular dichroism (CD) spectroscopy to analyze secondary structure content

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Dynamic light scattering (DLS) to evaluate homogeneity

  • Limited proteolysis to probe domain organization and folding

Methodologically, optimizing expression conditions is crucial for maintaining structural integrity. This includes testing different E. coli strains (e.g., C41(DE3) or C43(DE3) for membrane proteins), inducer concentrations, temperatures (often lowered to 16-20°C for improved folding), and the addition of specific lipids or detergents during purification to maintain native-like environments for hydrophobic regions.

What are the optimal conditions for functional characterization of recombinant Exig_2248?

Functional characterization of recombinant Exig_2248 requires carefully designed experimental conditions that account for its potential membrane association and cold-adapted properties. Based on analysis of similar proteins and E. sibiricum's biology, the following methodological approaches are recommended:

  • Temperature considerations:

    • Primary screening at multiple temperatures (4°C, 20°C, 37°C)

    • Comparative activity assays between psychrophilic and mesophilic conditions

    • Analysis of temperature-dependent conformational changes using thermal shift assays

  • Buffer optimization matrix:

Buffer ComponentRange to TestRationale
pH5.0 - 9.0 (0.5 increments)E. sibiricum grows in diverse environments
NaCl0 - 500 mMTest ionic strength requirements
Glycerol0 - 20%Stabilizes cold-adapted proteins
Divalent cations0 - 10 mM (Mg²⁺, Ca²⁺, Zn²⁺)Test metal cofactor requirements
Reducing agents0 - 5 mM DTT/BMEAssess disulfide dependency
DetergentsVarious (DDM, LDAO, etc.)For membrane protein solubilization
  • Membrane reconstitution systems:

    • Nanodiscs with varying lipid compositions

    • Liposome incorporation assays

    • Bicelle systems for structural studies

The experimental workflow should include:

  • Initial activity screening using a protein thermal shift assay to identify stabilizing conditions

  • Targeted functional assays based on bioinformatic predictions (e.g., binding assays, enzymatic activity tests)

  • Validation of activity in membrane-mimetic environments

For cold adaptation studies specifically, researchers should incorporate temperature-dependent kinetic measurements to determine activation energy (Eₐ) parameters, which often reveal distinctive properties of psychrophilic enzymes compared to mesophilic counterparts.

How can researchers effectively design protein-protein interaction studies involving Exig_2248?

Investigating the protein-protein interaction (PPI) network of Exig_2248 requires methodological approaches that accommodate its membrane association while maintaining conditions relevant to E. sibiricum's biology:

  • Primary screening methods:

    • Bacterial two-hybrid system modified for membrane proteins

    • Split-GFP complementation assays

    • MYTH (Membrane Yeast Two-Hybrid) system for transmembrane interactions

  • Validation and characterization approaches:

    • Co-immunoprecipitation with anti-His antibodies

    • Crosslinking mass spectrometry (XL-MS)

    • Surface plasmon resonance (SPR) with detergent-solubilized or nanodisc-incorporated protein

    • Microscale thermophoresis (MST) for quantitative binding parameters

  • Experimental design considerations:

Experimental ElementKey ConsiderationsMethodological Approach
Expression systemMaintaining native interactionsCo-expression in E. coli or cell-free systems
TemperaturePhysiological relevanceConduct experiments at 4-25°C
Detergent selectionMaintaining structural integrityScreen multiple detergents via thermal shift
Salt concentrationElectrostatic interactionsTest range from 50-300 mM NaCl
Tag interferenceMinimizing disruptionCompare N- and C-terminal tags

A systematic workflow should include:

  • In silico prediction of potential interaction partners based on genomic context

  • Primary screening in E. coli using bacterial two-hybrid or split-GFP systems

  • Validation of identified interactions using at least two orthogonal methods

  • Quantitative characterization of binding parameters using biophysical techniques

  • Functional validation through mutagenesis of predicted interaction interfaces

When analyzing results, researchers should consider the possibility of indirect interactions within larger complexes and utilize controlled partial proteolysis experiments to map interaction domains within the Exig_2248 sequence.

What crystallization strategies are most effective for structural determination of Exig_2248?

Crystallizing membrane-associated proteins like Exig_2248 presents significant challenges requiring specialized approaches. Based on successful strategies with similar proteins, the following methodological framework is recommended:

  • Pre-crystallization sample preparation:

    • Detergent screening (maltoside series, glucosides, fos-cholines)

    • Lipid cubic phase (LCP) preparation

    • Bicelle formulation with varying lipid compositions

    • Fab fragment co-crystallization to increase hydrophilic surfaces

  • Crystallization condition matrix:

ParameterInitial ScreenOptimization Range
Detergent concentration1-3× CMC0.5-5× CMC
LCP composition60:40 monoolein:proteinVarious lipid ratios
PrecipitantsPEG 400-4000, MPD, 2-methyl-2,4-pentanediol5-40% w/v
Salt additives100-500 mM various salts50-1000 mM
pH range5.5-8.50.2 pH unit increments
Temperature4°C, 16°C, 20°CFine gradient 4-25°C
  • Advanced techniques for challenging membrane proteins:

    • Lipidic cubic phase (LCP) crystallization

    • HiLiDe (High Lipid Detergent) method

    • Bicelle crystallization

    • Antibody fragment co-crystallization

    • Surface entropy reduction through targeted mutations

The crystallization workflow should incorporate:

  • Initial broad screening using sparse matrix screens designed for membrane proteins

  • Secondary grid screening around promising conditions

  • Crystal optimization through additive screening, including specific lipids from E. sibiricum

  • Analysis of crystal packing to identify potential crystal contacts

  • Systematic variation of construct boundaries to remove disordered regions

For Exig_2248 specifically, consider:

  • Testing crystallization at low temperatures (4-16°C) to maintain native conformation

  • Incorporating native E. sibiricum lipids extracted from bacteria grown at low temperatures

  • Utilizing nanobodies or designed ankyrin repeat proteins (DARPins) as crystallization chaperones

If X-ray crystallography proves challenging, complementary approaches such as cryo-electron microscopy or NMR spectroscopy of selectively labeled samples should be considered for structural determination.

How does Exig_2248 compare functionally to homologous proteins in other bacterial species?

Exig_2248 belongs to the UPF0316 protein family, with homologs distributed across various bacterial phyla. Comparative analysis reveals important insights about its potential functions and evolutionary adaptations:

  • Sequence conservation patterns:

    • The N-terminal hydrophobic region shows higher conservation across species, suggesting functional importance

    • The central domain contains family-specific motifs that differentiate UPF0316 proteins

    • C-terminal regions display greater variability, potentially indicating species-specific adaptations

  • Comparative analysis table of selected homologs:

OrganismProtein IDIdentity to Exig_2248HabitatKey Sequence Differences
E. sibiricumExig_2248100%Permafrost, cold environmentsReference sequence
E. antarcticumWP_006647453.1~85%Antarctic soilAdditional polar residues in transmembrane regions
B. subtilisYPQ45_12505~40%Soil, mesophilicFewer hydrophobic residues, different loop regions
S. aureusWP_000793757.1~35%Human microbiomeExtended C-terminal domain
P. cryohalolentisWP_011432243.1~45%Arctic seawaterModified glycine motifs, cold-adapted features
  • Functional implications from comparative genomics:

    • Genetic context analysis shows co-occurrence with genes involved in membrane organization

    • In psychrophilic species, the protein shows characteristic cold-adaptation signatures (increased glycine content, reduced proline, increased polar residues in buried positions)

    • Transcriptomic data from multiple species suggests upregulation under membrane stress conditions

Methodologically, researchers should approach comparative analysis through:

  • Multiple sequence alignment using MUSCLE or MAFFT algorithms optimized for transmembrane proteins

  • Phylogenetic reconstruction using maximum likelihood or Bayesian approaches

  • Positive selection analysis to identify adaptively evolving residues

  • Structural homology modeling using the evolutionary information

  • Experimental validation of predicted functional differences through heterologous expression and complementation studies

The comparative approach helps formulate testable hypotheses about Exig_2248 function and guides the design of site-directed mutagenesis experiments targeting evolutionarily significant residues.

How can researchers effectively interpret contradictory data when studying novel proteins like Exig_2248?

When investigating novel proteins like Exig_2248 with limited functional annotation, researchers often encounter seemingly contradictory experimental results. A systematic methodological framework for resolving these contradictions includes:

  • Critical evaluation of experimental conditions:

    • Temperature-dependent effects may yield different results between standard (37°C) and psychrophilic (4-20°C) conditions

    • Buffer composition variations, particularly ionic strength and pH, can dramatically alter membrane protein behavior

    • Expression system differences (E. coli vs. native expression) may impact post-translational modifications or folding

  • Data contradiction resolution workflow:

Type of ContradictionMethodological ApproachValidation Strategy
Localization discrepanciesMultiple tagging approaches (N-terminal, C-terminal, internal)Complementary microscopy techniques with cellular fractionation
Functional assignmentsParallel assays under varying conditionsIn vivo validation in E. sibiricum using gene deletion/complementation
Binding partner inconsistenciesOrthogonal binding assays with controlled stoichiometryCompetition experiments with predicted partners
Structural predictionsMultiple modeling algorithms with experimental validationLimited proteolysis coupled with mass spectrometry
  • Integrative data analysis approaches:

    • Bayesian network analysis to integrate multiple data types

    • Weighted scoring systems that prioritize direct experimental evidence

    • Meta-analysis methodologies that account for experimental conditions

The recommended methodological approach for addressing contradictory data involves:

  • Systematic documentation of all experimental conditions

  • Replication of key experiments with controlled variation of critical parameters

  • Development of an E. sibiricum-based validation system when possible

  • Integration of computational predictions with experimental validation

  • Collaborative cross-laboratory validation for key findings

Researchers should particularly consider how the unique physiological context of E. sibiricum (cold adaptation, specific membrane composition) might explain apparent contradictions when Exig_2248 is studied in heterologous systems or standard conditions.

What are the potential biotechnological applications of recombinant Exig_2248?

The unique properties of Exig_2248, particularly its cold adaptation and membrane association, suggest several promising biotechnological applications that researchers can explore:

  • Cold-adapted biocatalysis:

    • If enzymatic activity is confirmed, Exig_2248 could serve as a template for low-temperature industrial processes

    • Engineering enhanced stability while maintaining cold activity through directed evolution

    • Applications in detergent formulations, food processing, or bioremediation in cold environments

  • Membrane technology applications:

Potential ApplicationUnderlying PrincipleRequired Validation
Biosensor developmentMembrane association with specific binding propertiesLigand binding characterization
Antimicrobial peptide designSequence motifs with membrane-disrupting potentialActivity testing against pathogenic bacteria
Cold-stable liposome formulationIntegration of protein to enhance stabilityFreeze-thaw stability assays
Protein delivery systemsCell penetrating propertiesCellular uptake studies
  • Industrial process enhancement:

    • Low-temperature fermentation improvements

    • Cold-active detergent additives

    • Bioremediation in cold environments

  • Structural biology tools:

    • Membrane protein crystallization chaperones

    • Cryo-EM grid preparation stabilizers

The methodological approach for biotechnological development should include:

  • Function-based screening using diverse substrate libraries

  • Structure-guided protein engineering to enhance desired properties

  • Stability optimization through computational design and directed evolution

  • Application-specific formulation development

  • Scalability and economic feasibility assessment

For industrial applications specifically, researchers should conduct comparative studies between wild-type Exig_2248 and engineered variants, focusing on:

  • Temperature-activity profiles (4-60°C)

  • pH tolerance ranges (pH 4-10)

  • Organic solvent compatibility

  • Long-term storage stability

  • Compatibility with existing industrial processes

The cold-adapted nature of this protein may provide particular advantages in low-temperature bioprocesses where mesophilic enzymes demonstrate limited activity.

How can researchers address expression and purification challenges specific to Exig_2248?

The recombinant expression and purification of Exig_2248 presents several technical challenges common to membrane-associated proteins. A systematic troubleshooting approach includes:

  • Expression optimization strategies:

ChallengePotential SolutionImplementation Approach
Inclusion body formationDecrease induction temperature to 16-18°CTest gradients from 12-25°C
Low expression levelsCodon optimization for E. coliDesign synthetic gene with optimized codons
Toxicity to host cellsUse C41(DE3) or C43(DE3) strainsCompare growth curves between strains
Improper membrane insertionInclude leader sequences (pelB, OmpA)Western blotting of membrane fractions
Proteolytic degradationCo-expression with chaperonesGroEL/ES, DnaK/J/GrpE co-expression
  • Purification optimization workflow:

    • Membrane isolation through differential centrifugation

    • Detergent screening matrix (mild to harsh detergents)

    • Optimized affinity chromatography with imidazole gradient elution

    • Size exclusion chromatography for final polishing

    • Quality control through dynamic light scattering and SDS-PAGE

  • Protein stability enhancement methods:

    • Addition of specific lipids from E. sibiricum during purification

    • Glycerol supplementation (10-20%)

    • Use of stabilizing additives (TMAO, sucrose, specific ions)

    • Nanodiscs or amphipol incorporation for long-term stability

Methodologically, a recommended approach involves:

  • Initial small-scale expression testing across multiple conditions (temperature, induction time, media composition)

  • Membrane fractionation assessment via Western blotting

  • Detergent extraction optimization using fluorescence-based thermostability assays

  • Chromatography condition screening with design of experiments (DoE) approach

  • Final verification of homogeneity and functionality

When troubleshooting expression issues specifically for Exig_2248, researchers should consider:

  • The potential benefits of expressing at low temperatures (16-20°C) to mimic its native environment

  • The importance of incorporating specific lipids that may be required for proper folding

  • The possibility of co-expressing with other E. sibiricum proteins that may form a functional complex

What experimental controls are essential when characterizing the function of Exig_2248?

Rigorous experimental design for functional characterization of Exig_2248 requires comprehensive controls to ensure reliable and interpretable results:

  • Essential negative controls:

    • Empty vector-transformed E. coli (for background activity)

    • Heat-denatured Exig_2248 protein (for non-specific effects)

    • Scrambled peptide controls for binding studies

    • Tag-only protein preparations (to control for tag interference)

    • Mutation of predicted active site residues (for enzymatic assays)

  • Positive control considerations:

    • Well-characterized homologous proteins from related organisms

    • Known interacting partners for binding assays

    • Established membrane protein controls for localization studies

  • Control matrix for key experiment types:

Experiment TypeNegative ControlsPositive ControlsValidation Controls
Binding assaysBSA, tag-only proteinKnown binding partnersCompetitive inhibition
Enzymatic activityHeat-inactivated enzymeCommercial enzyme standardsDose-dependent inhibition
Structural studiesDenatured protein samplesSimilar membrane proteinsChemical crosslinking
Localization studiesNon-specific fluorescent tagsKnown membrane markersFractionation validation
  • Methodological validation controls:

    • Inter-laboratory reproducibility testing

    • Multiple detection methods for key findings

    • Biological replicates across different protein preparations

    • Technical replicates to assess method variability

The recommended approach for implementing a comprehensive control strategy involves:

  • Experimental design review by researchers experienced with membrane proteins

  • Pilot studies to identify key variables affecting reproducibility

  • Development of quantitative quality control metrics for protein preparations

  • Establishment of acceptance criteria for each control type

  • Blind testing of samples when possible to minimize bias

For studying cold-adapted properties specifically, researchers should include parallel experiments with mesophilic homologs at various temperatures (4°C, 20°C, 37°C) to distinguish general protein behaviors from cold-adaptation characteristics.

How should researchers interpret conflicting bioinformatic predictions about Exig_2248 function?

Bioinformatic analysis of novel proteins like Exig_2248 often yields conflicting functional predictions. A structured approach to resolving these conflicts includes:

  • Critical evaluation of prediction algorithms:

    • Algorithm-specific biases and limitations (e.g., training set composition)

    • Confidence scores and statistical significance assessments

    • Performance on benchmark datasets of membrane proteins

    • Appropriateness for cold-adapted bacterial proteins

  • Integration of multiple prediction approaches:

Prediction TypeRecommended ToolsIntegration Strategy
Transmembrane topologyTMHMM, Phobius, HMMTOPConsensus approach with majority voting
Functional domainInterProScan, CDD, PFAMHierarchical classification of confidence
Protein-protein interactionsSTRING, PSICQUIC, PrePPINetwork-based validation and clustering
3D structure predictionAlphaFold, RoseTTAFold, I-TASSEREnsemble modeling with RMSD assessment
Binding site prediction3DLigandSite, COACH, FTSiteSpatial clustering of predictions
  • Experimental validation strategy for conflicting predictions:

    • Targeted mutagenesis of residues with conflicting functional assignments

    • Domain truncation experiments to isolate functional regions

    • Chimeric protein construction with well-characterized domains

    • Direct assessment of competing functional hypotheses with orthogonal assays

The recommended methodological workflow includes:

  • Comprehensive collection of predictions from multiple algorithms

  • Systematic documentation of confidence scores and methodological limitations

  • Development of a weighted consensus approach that prioritizes:

    • Predictions with experimental validation in related proteins

    • Consistency with the protein's genomic context

    • Evolutionary conservation patterns

    • Structural feasibility

  • Design of critical experiments to differentiate between competing hypotheses

When analyzing Exig_2248 specifically, researchers should consider how its adaptation to cold environments might affect the accuracy of prediction algorithms trained primarily on mesophilic proteins, and adjust confidence assessments accordingly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.