Recombinant Exiguobacterium sibiricum UPF0365 protein Exig_0818 (Exig_0818)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
floA; Exig_0818; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
Exig_0818
Target Protein Sequence
MTPELLTVLLITGGILIFLAIFFTLVPIPLWISSLAAGVRVSIFTLVGMRLRRVTPSKIV NPLIKAVKAGINLNTNQLESHYLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNV LEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGV ISTIGSCQDQKEVLENPEMISRTVLAKGLDSGTAFEILSIDIADVDIGKNIGAVLQTDQA EADKNIAQAKAEERRAMAIASEQEMKSRVEEMRAKVVAAEAEVPLAIAEALRDGNFSVMD YANYLNVTADTKMRQAIGGQSSPNDTQ
Uniprot No.

Target Background

Function
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a crucial role in maintaining membrane fluidity.
Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

What is the basic characterization of Exiguobacterium sibiricum UPF0365 protein Exig_0818?

Exiguobacterium sibiricum UPF0365 protein Exig_0818 is a protein encoded by the Exig_0818 gene in Exiguobacterium sibiricum strain DSM 17290 / JCM 13490 / 255-15, with UniProt accession number B1YL66 . The full-length protein consists of 327 amino acids with a sequence that suggests transmembrane domains based on the hydrophobic regions in its primary structure (MTPELLTVLLITGGILIFLAIFFTLVPIPLWISSLAAGVRVSIFTLVGMRLRRVTPSKIVNPLIKAVKAGINLNTNQLESHYLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNVLEAVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIDRLVGGAGEETVIARVGEGVISTIGSCQDQKEVLENPEMISRTVLAKGLDSGTAFEILSIDIADVDIGKNIGAVLQTDQAEADKNIAQAKAEERRAMAIASEQEMKSRVEEMRAKVVAAEAEVPLAIAEALRDGNFSVMDYANYLNVTADTKMRQAIGGQSSPNDTQ) . The UPF0365 family designation indicates that this is a protein with an unknown function that has been recognized as a conserved protein family. Research into its function is ongoing, with current evidence suggesting it may be involved in membrane-associated processes based on its sequence characteristics.

How does Exig_0818 compare to other proteins in the UPF0365 family?

The UPF0365 family contains proteins with conserved domains across multiple bacterial species, though Exig_0818 specifically is characterized by its 327-amino acid length and distinctive hydrophobic regions that suggest transmembrane functionality . Comparative sequence analysis reveals that while the core functional domains remain conserved across the UPF0365 family, Exig_0818 contains unique regions that may confer specialized functions adapted to the extremophilic nature of Exiguobacterium sibiricum, which thrives in cold environments. Unlike other characterized membrane proteins from this organism, such as Exiguobacterium sibiricum rhodopsin (ESR) that functions as a light-driven proton pump , the specific transport or signaling role of Exig_0818 remains to be fully elucidated. Sequence alignments with homologous proteins from related bacteria could provide insights into evolutionary conservation patterns and potential functional significance of specific regions.

What are the optimal storage and handling conditions for working with recombinant Exig_0818?

For optimal preservation of recombinant Exig_0818 protein activity, storage at -20°C is recommended for routine use, while long-term storage should be at -80°C in a Tris-based buffer containing 50% glycerol that has been optimized specifically for this protein . It is critical to avoid repeated freeze-thaw cycles as these can significantly compromise protein integrity and function; instead, researchers should prepare smaller working aliquots that can be stored at 4°C for up to one week . When handling the protein, maintain sterile conditions and use appropriate buffers that maintain protein stability, typically at physiological pH ranges unless specifically investigating pH-dependent activities. Prior to experimental use, centrifugation of thawed protein samples at low speed (approximately 10,000 × g for 10 minutes at 4°C) can help remove any potential aggregates that might have formed during storage. Following the Taguchi design of experiments approach may help optimize handling parameters with minimal experimental runs5.

How should researchers design experiments to investigate the function of Exig_0818?

Researchers investigating Exig_0818 function should implement a systematic experimental approach beginning with bioinformatic analysis to identify conserved domains and predict potential functional roles, followed by heterologous expression systems for in vitro characterization . The experimental design should incorporate the Taguchi method to efficiently optimize multiple parameters simultaneously, reducing the number of required experiments while still obtaining statistically significant results5. For instance, instead of conducting a full factorial design requiring 2^3 (8) experiments for three two-level parameters, the Taguchi approach would require only four well-designed experiments5. Key parameters to investigate include buffer composition, pH range, temperature stability, and interaction with potential binding partners or substrates. Based on the protein's putative membrane localization, researchers should include membrane-based assays such as liposome reconstitution to assess transport or signaling functions, similar to methodologies used for studying the proton-pumping mechanism of Exiguobacterium sibiricum rhodopsin .

What controls should be included when conducting functional assays with Exig_0818?

When designing functional assays for Exig_0818, researchers must include multiple control conditions to ensure valid and interpretable results. Negative controls should include buffer-only conditions as well as heat-denatured protein samples to distinguish specific activity from non-specific effects . Positive controls should utilize proteins with well-characterized functions similar to hypothesized roles for Exig_0818, particularly other membrane proteins from Exiguobacterium sibiricum with established functional assays . When investigating potential membrane-associated functions, controls for membrane integrity and non-specific leakage are essential. For binding or interaction studies, competition assays with unlabeled putative ligands should be performed to confirm specificity. Additionally, researchers should consider time-course experiments with multiple protein concentrations to establish dose-dependent relationships. Implementation of the Taguchi experimental design principles can help determine which factors significantly influence experimental outcomes while minimizing the number of control conditions required5.

How can researchers effectively use the Taguchi method to optimize experiments with Exig_0818?

To effectively implement the Taguchi method for Exig_0818 research, investigators should first identify the critical parameters (factors) affecting their experimental outcomes and determine appropriate levels for each factor5. For protein functional studies, typical factors include pH, temperature, salt concentration, and substrate concentration, with each factor tested at two or more levels. The appropriate orthogonal array should be selected based on the number of factors and levels; for example, a P3L2 design (three parameters, two levels each) would require only four experimental runs instead of eight in a full factorial design5. After conducting the experiments according to the Taguchi array, researchers should analyze the results using signal-to-noise ratios to identify optimal conditions that maximize desired outcomes while minimizing variability. This approach is particularly valuable for identifying optimal crystallization conditions, buffer compositions for stability studies, or reaction conditions for enzymatic assays involving Exig_0818. The statistical validity of the optimized conditions should be confirmed with validation experiments under the predicted optimal parameters5.

What approaches are recommended for determining the three-dimensional structure of Exig_0818?

For elucidating the three-dimensional structure of Exig_0818, researchers should consider a multi-method approach that capitalizes on the protein's characteristics. X-ray crystallography remains the gold standard for high-resolution structural determination, requiring pure, homogeneous protein samples that can form well-ordered crystals . Given the presence of hydrophobic regions in Exig_0818 that suggest transmembrane domains, researchers may need to use specialized crystallization techniques such as lipidic cubic phase crystallization or the addition of detergents and lipids that mimic the native membrane environment. Alternatively, cryo-electron microscopy (cryo-EM) offers advantages for membrane proteins without requiring crystallization, though sample preparation and data processing present their own challenges. For complementary structural information, solution NMR could be employed for specific domains, particularly those outside the membrane. Computational approaches, including homology modeling based on structurally characterized proteins in the UPF0365 family, can provide initial structural insights, especially when combined with experimental validation techniques such as circular dichroism spectroscopy to confirm secondary structure elements.

How can hydrogen-bonding networks be analyzed in Exig_0818 similar to studies on Exiguobacterium sibiricum rhodopsin?

Analysis of hydrogen-bonding networks in Exig_0818 should adapt methodologies similar to those used in Exiguobacterium sibiricum rhodopsin (ESR) studies, employing a combination of computational and experimental approaches . Researchers should begin with molecular dynamics simulations to identify potential hydrogen bond networks, followed by targeted mutagenesis of predicted key residues to experimentally validate their functional significance. The linear Poisson-Boltzmann equation can be applied to calculate electrostatic potentials around key residues, while quantum mechanical/molecular mechanical (QM/MM) approaches with polarizable continuum models provide insights into proton transfer energetics across identified networks . Spectroscopic methods including FTIR difference spectroscopy can detect changes in hydrogen bonding during functional cycles, while NMR studies focusing on chemical shift perturbations of key residues can reveal hydrogen bond strength and dynamics. For Exig_0818 specifically, researchers should focus on identifying conserved acidic and basic residues that might form salt bridges similar to the Asp85-His57 interaction in ESR, as these could be critical for maintaining structural integrity or facilitating functional mechanisms .

What methods should be used to investigate the membrane topology of Exig_0818?

Investigation of Exig_0818 membrane topology requires a combination of computational prediction and experimental validation approaches. Computational methods should begin with transmembrane prediction algorithms such as TMHMM, HMMTOP, and Phobius to identify potential membrane-spanning regions based on the protein's amino acid sequence . These predictions should be complemented by hydropathy plot analysis and sequence comparison with proteins of known topology. For experimental validation, researchers should employ techniques such as substituted cysteine accessibility method (SCAM), where cysteine residues are systematically introduced throughout the protein and their accessibility to membrane-impermeant sulfhydryl reagents is assessed. Protease protection assays can determine which regions are protected by the membrane, while reporter fusion constructs (such as PhoA or GFP) can identify domains facing either side of the membrane. Chemical crosslinking followed by mass spectrometry can map proximity relationships between protein domains and membrane components. Cryo-electron microscopy of Exig_0818 reconstituted in nanodiscs or liposomes provides direct visualization of membrane insertion orientation, complementing the biochemical approaches.

How might Exig_0818 function compare to the proton-pumping mechanism of Exiguobacterium sibiricum rhodopsin?

While both Exig_0818 and Exiguobacterium sibiricum rhodopsin (ESR) are membrane proteins from the same organism, their functional mechanisms likely differ significantly based on their structural characteristics . ESR functions as a light-driven proton pump utilizing a specific H-bond network [Asp85···His57···H₂O···Glu214] that serves as a proton-conducting pathway toward the protein bulk surface . In contrast, Exig_0818's amino acid sequence suggests a different functional paradigm, possibly related to substrate transport or signaling rather than light-driven proton pumping. Unlike ESR, which contains retinal as a chromophore for light absorption, Exig_0818 lacks obvious chromophore-binding sites. The transmembrane regions of Exig_0818 suggest it may form a channel or transporter, potentially utilizing proton gradients established by proteins like ESR but serving a different cellular function. Experimental approaches to compare these functions should include membrane potential measurements, substrate transport assays, and evaluation of activity across pH gradients to determine if Exig_0818 displays any dependency on the proton-motive force generated by proton pumps like ESR .

What are the recommended approaches for identifying potential binding partners or substrates of Exig_0818?

Identification of Exig_0818 binding partners or substrates requires a multi-faceted approach combining in silico prediction with experimental validation. Researchers should begin with computational analysis including docking simulations, molecular dynamics, and binding site predictions based on the protein's sequence and predicted structure . For experimental identification, affinity chromatography using immobilized Exig_0818 as bait can capture interacting proteins from cellular lysates, followed by mass spectrometry identification. Chemical crosslinking coupled with mass spectrometry (XL-MS) can identify proteins in close proximity to Exig_0818 in native membrane environments. For substrate identification, researchers should implement transport assays using reconstituted Exig_0818 in liposomes or proteoliposomes, testing various metabolites, ions, or signaling molecules as potential substrates. Surface plasmon resonance (SPR) or microscale thermophoresis can quantify binding affinities for candidate interactors. Systematic mutagenesis of predicted binding sites followed by functional assays can confirm the significance of specific residues in substrate recognition. Co-immunoprecipitation experiments using antibodies against Exig_0818 can pull down physiologically relevant binding partners from native membrane preparations.

How can researchers determine if Exig_0818 functions within a larger protein complex?

To investigate whether Exig_0818 functions within a larger protein complex, researchers should employ a combination of biochemical, biophysical, and genetic approaches. Native gel electrophoresis, particularly Blue Native PAGE, can separate intact protein complexes from solubilized membranes while preserving native protein-protein interactions . Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides information about complex molecular weight and stoichiometry in solution. Chemical crosslinking followed by mass spectrometry analysis can capture transient interactions and map the architecture of protein complexes containing Exig_0818. Co-immunoprecipitation with antibodies against Exig_0818 can pull down interacting partners, while reciprocal co-IPs can confirm these interactions. For in vivo validation, proximity labeling methods such as BioID or APEX2 can identify proteins in close proximity to Exig_0818 in living cells. Genetic approaches, including synthetic lethality screens or suppressor mutation analysis, can identify functional relationships with other genes/proteins. Cryo-electron microscopy is particularly valuable for structural characterization of purified complexes, while in-cell fluorescence techniques such as Förster resonance energy transfer (FRET) can confirm interactions in the native cellular environment.

How can high-throughput screening be designed to identify modulators of Exig_0818 function?

Designing a high-throughput screening (HTS) campaign for Exig_0818 modulators requires establishing a robust, reproducible assay that directly measures protein function or a suitable surrogate readout. Researchers should develop a primary assay based on the hypothesized function of Exig_0818, such as transport activity for specific substrates or binding to predicted interaction partners . This primary assay should be miniaturized to a 384- or 1536-well format and optimized using the Taguchi method to identify critical parameters affecting signal-to-background ratio, Z'-factor, and assay reproducibility5. For membrane proteins like Exig_0818, reconstitution in nanodiscs or liposomes containing appropriate fluorescent reporters can enable functional readouts in HTS format. Researchers should implement a tiered screening approach, beginning with a diverse compound library (5,000-10,000 compounds) followed by focused libraries based on initial hits. Secondary assays should be designed to eliminate false positives and confirm target engagement, including surface plasmon resonance, thermal shift assays, or competitive binding assays. Counter-screening against related proteins can establish selectivity profiles, while structure-activity relationship studies on confirmed hits can guide medicinal chemistry optimization of lead compounds.

How can advanced computational methods be applied to predict the evolutionary significance of Exig_0818?

Advanced computational methods for assessing the evolutionary significance of Exig_0818 should integrate phylogenetic analysis with structural bioinformatics and molecular dynamics simulations. Researchers should begin by constructing comprehensive multiple sequence alignments of UPF0365 family proteins across diverse bacterial phyla, identifying signature sequences unique to extremophiles like Exiguobacterium sibiricum . Bayesian evolutionary models and maximum likelihood methods can reconstruct the protein's evolutionary history, identifying episodes of positive selection that might indicate adaptation to extreme environments. Coevolution analysis using methods such as Direct Coupling Analysis (DCA) or Statistical Coupling Analysis (SCA) can identify networks of co-evolving residues that maintain functional integrity across evolutionary time. Molecular dynamics simulations under varying temperature conditions can reveal adaptations that maintain structural stability in the cold environments where Exiguobacterium sibiricum thrives. Ancestral sequence reconstruction can generate hypothetical progenitor sequences of Exig_0818, which can be experimentally synthesized and characterized to directly test evolutionary hypotheses. Integration of these computational analyses with experimental data can illuminate how environmental pressures shaped Exig_0818's function and can guide experimental design for testing key hypotheses about its role in extremophile adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.