Recombinant Exiguobacterium sibiricum UPF0756 membrane protein Exig_2210 (Exig_2210)

Shipped with Ice Packs
In Stock

Description

Definition and Classification of Recombinant Exiguobacterium sibiricum UPF0756 Membrane Protein Exig_2210 (Exig_2210)

Exig_2210 is a recombinant membrane protein derived from Exiguobacterium sibiricum, a psychrotrophic bacterium isolated from Siberian permafrost . It belongs to the UPF0756 family of membrane proteins and is annotated under the UniProt ID B1YKA9 . The protein is expressed as a full-length construct (1–156 amino acids) in E. coli and is His-tagged for purification .

Production and Purity

ParameterDetails
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE confirmed)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for stability

A. Thermal Adaptation in Exiguobacterium sibiricum

E. sibiricum thrives in temperatures ranging from -5°C to 39°C, making it a model for cold adaptation . While Exig_2210’s specific role is not explicitly detailed in available studies, its membrane localization suggests potential involvement in:

  • Membrane fluidity regulation: Cold-adapted organisms often modify lipid composition or protein structure to maintain membrane integrity .

  • Proton transport or sensing: Proteorhodopsins in related psychrotrophs (e.g., Exiguobacterium sibiricum rhodopsin) exhibit proton-pumping activity , though Exig_2210’s homology to these proteins remains unconfirmed.

Applications in Research

Application AreaDetails
Structural StudiesHis-tagged Exig_2210 enables X-ray crystallography or cryo-EM analysis .
Immune AssaysRecombinant Exig_2210 is used in ELISA kits for antibody detection .
BiotechnologyPotential use in cold-stable enzyme systems or cryopreservation .

Comparative Analysis with Related Proteins

FeatureExig_2210 (B1YKA9)E. sibiricum Rhodopsin (C4L477)
Length156 aa154 aa
TagHis
Proton TransportUnconfirmedConfirmed (lysine-based proton donor)
Adaptation ContextCold adaptation Proton pumping in permafrost

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we understand your specific needs. If you require a particular format, please indicate your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice packaging is preferred, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be maintained at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For optimal long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We carefully select the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Exig_2210; UPF0756 membrane protein Exig_2210
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Target Names
Exig_2210
Target Protein Sequence
MEAYLFLIGLVLIGVIAQNKSLIIAAAFLLIIKAIGLDGRLFPSLQAKGITWGVTLITAA ILVPIATGDIGFRELLNSVRGHIGIISFLAGIFVAIIAAHGVGLMKEDPLVTTALLAGTI LAVGLFRGVPVGPLIGAGIAALVIGMWDIIVKAISG
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Exiguobacterium sibiricum and why is its UPF0756 membrane protein (Exig_2210) of interest to researchers?

Exiguobacterium sibiricum is a low G+C, Gram-positive facultative anaerobic bacterium that has been isolated from diverse and often extreme environments, including ancient Siberian permafrost, Greenland glacial ice, hot springs at Yellowstone National Park, plant rhizospheres, and food processing facilities . The UPF0756 membrane protein (Exig_2210) is of particular interest to researchers because it belongs to an uncharacterized protein family that may play a role in the organism's adaptation to extreme environments. The protein's structure, function, and potential role in Exiguobacterium's remarkable environmental adaptability make it a valuable subject for fundamental research in extremophile biology, membrane protein structure, and potential biotechnological applications.

How does Exiguobacterium sibiricum's phylogeny relate to its protein expression patterns?

Exiguobacterium strains form two distinct phylogenetic divisions that generally correlate with their temperature growth ranges . Through comparative genomic analyses, researchers have found that psychrotrophic (cold-adapted) and thermophilic (heat-adapted) isolates typically belong to different divisions, with few exceptions such as the Greenland ice isolate GIC31 . This phylogenetic division likely influences the expression patterns and structural adaptations of membrane proteins, including Exig_2210.

The expression of membrane proteins like Exig_2210 may vary significantly between these divisions as an adaptation to different temperature extremes. Psychrotrophic strains might express protein variants with greater flexibility at low temperatures, while thermophilic strains might express variants with enhanced stability at high temperatures. Comparing the expression patterns and structural variations of Exig_2210 across different Exiguobacterium strains can provide insights into temperature adaptation mechanisms at the molecular level.

What is the recommended expression system for recombinant Exig_2210 protein?

The recommended expression system for recombinant Exig_2210 protein is Escherichia coli . While the search results don't provide specific details on the exact E. coli strain or expression vector used for Exig_2210, we can draw insights from similar recombinant membrane protein expression methodologies.

For optimal expression, researchers should consider the following methodological approach:

  • Vector selection: A vector with an inducible promoter (such as T7) and appropriate fusion tags (His-tag is commonly used for Exig_2210) .

  • Host strain selection: E. coli strains optimized for membrane protein expression, such as C41(DE3), C43(DE3), or Lemo21(DE3).

  • Induction conditions: Temperature, inducer concentration, and induction time should be optimized. Lower temperatures (16-25°C) often improve membrane protein folding.

  • Growth media: Enriched media such as Terrific Broth or auto-induction media may enhance yields.

Similar to the approach used for Klebsiella pneumoniae OmpA, fusion of a short peptide to the N-terminus might facilitate high-level expression of recombinant Exig_2210 . This strategy has proven effective for other bacterial membrane proteins and could potentially improve yields for Exig_2210 as well.

What purification strategy should be employed for obtaining high-purity Exig_2210 protein?

For high-purity Exig_2210 protein purification, a multi-step approach is recommended based on the protein's characteristics and common membrane protein purification protocols:

  • Cell lysis: Use mechanical disruption methods (sonication, French press) in combination with suitable detergents to solubilize membrane proteins.

  • Initial purification: Since the recombinant protein contains a His-tag , immobilized metal affinity chromatography (IMAC) serves as an effective first purification step.

  • Secondary purification: Size exclusion chromatography (SEC) helps remove aggregates and further increase purity.

  • Quality control: SDS-PAGE analysis should confirm >90% purity as specified for commercial preparations .

The purification protocol can be summarized in this table:

Purification StepMethodBuffer ComponentsExpected Outcome
Membrane isolationDifferential centrifugation50 mM Tris-HCl pH 8.0, 150 mM NaClEnriched membrane fraction
SolubilizationDetergent treatmentAbove buffer + 1% appropriate detergent (DDM, LDAO)Solubilized membrane proteins
IMACNi-NTA affinity chromatographyAbove buffer + 0.1% detergent + imidazole gradient>80% pure protein
SECGel filtration50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% detergent>90% pure protein

Following purification, the protein should be stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, as recommended for preserving stability .

How should researchers handle the reconstitution of lyophilized Exig_2210 protein?

Proper reconstitution of lyophilized Exig_2210 protein is crucial for maintaining its structural integrity and functional properties. The recommended procedure is as follows:

  • Initial preparation: Briefly centrifuge the vial containing lyophilized protein to ensure all content is at the bottom of the vial .

  • Reconstitution buffer: Use deionized sterile water to reconstitute the protein to a concentration of 0.1-1.0 mg/mL .

  • Stabilization: Add glycerol to a final concentration of 5-50% to enhance protein stability. The recommended default final concentration is 50% .

  • Aliquoting: Divide the reconstituted protein into small aliquots to avoid repeated freeze-thaw cycles.

  • Storage: Store aliquots at -20°C/-80°C for long-term use .

It's important to note that repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity. For short-term use (up to one week), working aliquots can be stored at 4°C .

What experimental approaches are most effective for determining the structure of Exig_2210?

Due to the challenges associated with membrane protein structural determination, a multi-technique approach is recommended for Exig_2210:

  • X-ray crystallography: Despite being challenging for membrane proteins, this remains the gold standard for high-resolution structural determination. Key methodological considerations include:

    • Screening multiple detergents to identify those maintaining protein stability

    • Using lipidic cubic phase (LCP) or bicelle crystallization approaches

    • Testing various crystallization conditions with robotic systems

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structure determination, especially for proteins resistant to crystallization.

  • NMR spectroscopy: Useful for dynamic studies and investigating protein-ligand interactions, though limited by protein size.

  • Computational approaches: Homology modeling and molecular dynamics simulations can provide structural insights, especially when experimental data is limited.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Valuable for mapping protein topology and identifying flexible regions.

How can researchers investigate the potential function of Exig_2210 given its uncharacterized status?

Investigating the function of an uncharacterized membrane protein like Exig_2210 requires a systematic approach combining multiple experimental and computational strategies:

  • Sequence-based analysis:

    • Identify conserved domains through database searches (Pfam, InterPro)

    • Perform phylogenetic analysis to identify relationships with characterized proteins

    • Examine conservation patterns across Exiguobacterium species from different environments

  • Structural prediction and analysis:

    • Use structure prediction tools (AlphaFold2, RoseTTAFold) to generate structural models

    • Compare predicted structures with known membrane protein structures

    • Identify potential binding pockets or functional sites

  • Experimental functional characterization:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Protein-protein interaction studies (pull-down assays, crosslinking)

    • Reconstitution in artificial membrane systems to test for transport or channel activity

    • Site-directed mutagenesis of predicted functional residues

  • Expression analysis:

    • Compare expression levels under different environmental stresses (temperature, pH, salinity)

    • Analyze co-expression patterns with proteins of known function

  • Comparative genomics:

    • Analyze genomic context of exig_2210 gene across different Exiguobacterium strains

    • Identify potential operons or gene clusters suggesting functional relationships

The combination of these approaches provides multiple lines of evidence to develop hypotheses about Exig_2210's function, which can then be tested through targeted experiments.

What methods should be used to analyze the membrane topology of Exig_2210?

Understanding the membrane topology of Exig_2210 is crucial for functional characterization. Several complementary methods should be employed:

  • Computational predictions:

    • Transmembrane topology prediction tools (TMHMM, Phobius, TOPCONS)

    • Hydropathy analysis to identify potential membrane-spanning regions

    • Signal peptide prediction (SignalP)

  • Biochemical approaches:

    • Cysteine scanning mutagenesis followed by accessibility studies

    • Protease protection assays to identify exposed regions

    • Glycosylation mapping using artificial glycosylation sites

  • Biophysical techniques:

    • Site-specific fluorescence labeling to track accessibility

    • EPR spectroscopy with site-directed spin labeling

    • FRET-based distance measurements between domains

  • Structural biology approaches:

    • Cryo-EM analysis with nanodiscs or amphipols

    • X-ray crystallography of protein in detergent micelles

    • Solid-state NMR for orientation information

Based on the amino acid sequence provided in search result , Exig_2210 contains multiple hydrophobic segments that likely form transmembrane domains. A preliminary topology model could be developed using computational predictions, then refined through selected experimental approaches above. This integrated approach would provide the most reliable topology map of Exig_2210 in the membrane.

How might Exig_2210 contribute to our understanding of extremophile adaptation mechanisms?

Exiguobacterium sibiricum is known for its remarkable adaptability to extreme environments, from permafrost to hot springs . The Exig_2210 membrane protein likely plays a significant role in this adaptability for several reasons:

  • Membrane adaptation to temperature extremes: Membrane proteins like Exig_2210 may help maintain membrane fluidity and integrity across wide temperature ranges. Comparing the structure and dynamics of Exig_2210 from psychrotrophic versus thermophilic Exiguobacterium strains could reveal temperature-specific adaptations at the molecular level .

  • Stress response mechanisms: The expression of Exig_2210 might be regulated in response to environmental stressors. Analysis of gene expression using DNA macroarrays has shown strain-specific hybridization profiles for stress-response genes in Exiguobacterium, suggesting specialized stress adaptation mechanisms .

  • Evolutionary insights: Phylogenetic analysis has revealed that Exiguobacterium strains form two distinct divisions that generally correlate with their growth temperature ranges . Studying how Exig_2210 varies across these divisions can provide insights into the evolution of extremophile adaptation.

  • Bioenergetic contributions: As a membrane protein, Exig_2210 might participate in maintaining proton gradients or other bioenergetic processes crucial for survival under extreme conditions.

Research methodologies should include comparative genomics, structural analysis, and functional characterization of Exig_2210 variants from Exiguobacterium strains isolated from different extreme environments. This approach could reveal how mutations or structural adaptations in this membrane protein contribute to the organism's remarkable environmental flexibility.

How can Exig_2210 be utilized in experimental designs for studying membrane protein folding and stability?

Exig_2210 presents a valuable model system for studying membrane protein folding and stability, particularly in the context of environmental extremes. Researchers can utilize this protein in the following experimental designs:

  • Temperature-dependent stability studies:

    • Circular dichroism (CD) spectroscopy to monitor secondary structure changes across temperature ranges

    • Differential scanning calorimetry (DSC) to determine melting temperatures

    • Intrinsic fluorescence to track tertiary structure alterations

  • Detergent screening experiments:

    • Systematic evaluation of protein stability in different detergents using size-exclusion chromatography

    • Thermal shift assays to identify stabilizing conditions

    • Activity assays (if function is known) to correlate stability with functionality

  • Membrane mimetic comparison studies:

    • Reconstitution in nanodiscs, liposomes, and amphipols

    • Comparing structural integrity in different membrane environments

    • Testing lipid composition effects on protein stability

  • Mutagenesis approaches:

    • Systematic mutation of key residues to identify stability determinants

    • Engineering stabilizing mutations based on extremophile adaptations

    • Creating chimeric proteins with domains from psychrophilic and thermophilic variants

  • Real-time folding analysis:

    • Stopped-flow measurements with fluorescence detection

    • Single-molecule FRET to track folding pathways

    • Hydrogen-deuterium exchange mass spectrometry to identify folding intermediates

These experimental approaches provide a comprehensive framework for using Exig_2210 as a model to understand fundamental principles of membrane protein stability, particularly in organisms adapted to extreme environments.

What experimental design considerations are important when studying potential interactions between Exig_2210 and other cellular components?

When designing experiments to study interactions between Exig_2210 and other cellular components, researchers should consider the following methodological approach:

  • Interaction partner identification:

    • Co-immunoprecipitation using anti-His antibodies (targeting the His-tag of recombinant Exig_2210)

    • Proximity labeling techniques (BioID, APEX) to identify proximal proteins in vivo

    • Cross-linking mass spectrometry to capture transient interactions

    • Bacterial two-hybrid screening for potential binding partners

  • Experimental design considerations:

    • Controls: Include appropriate negative controls (e.g., unrelated membrane proteins) and positive controls (known interacting pairs)

    • Replication: Perform at least three biological replicates for statistical reliability

    • Variables: Control for environmental factors that might affect protein-protein interactions (temperature, pH, ionic strength)

  • Validation approaches:

    • Microscopy-based co-localization studies

    • FRET or BRET to confirm interactions in living cells

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Functional relevance assessment:

    • Mutagenesis of predicted interaction sites

    • Phenotypic analysis of interaction-disrupting mutations

    • Reconstitution systems to test functional consequences of interactions

A well-designed experimental approach would follow the basic principles outlined in experimental design resources , including proper control of variables, sufficient replication, and careful data analysis. The experiment should begin with broad screening approaches to identify potential interactors, followed by targeted validation experiments and functional characterization of confirmed interactions.

What are common challenges in expressing recombinant Exig_2210 and how can they be addressed?

Membrane proteins like Exig_2210 present several challenges during recombinant expression. Here are common issues and research-oriented solutions:

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions by testing multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)), varying induction temperatures (16-37°C), and IPTG concentrations (0.1-1.0 mM). Adding a short peptide to the N-terminus can facilitate high-level expression, as demonstrated with other membrane proteins .

  • Protein misfolding and inclusion body formation:

    • Challenge: Exig_2210 may form inclusion bodies in E. coli, similar to other recombinant membrane proteins .

    • Solution: Reduce expression rate by lowering temperature (16-20°C) and inducer concentration. Alternatively, develop inclusion body refolding protocols using systematic detergent screening or use fusion partners that enhance solubility (MBP, SUMO).

  • Protein instability after purification:

    • Challenge: Purified membrane proteins often aggregate or denature during storage.

    • Solution: Use stabilizing agents such as trehalose (6%) in storage buffers and maintain glycerol at 5-50% . Store as recommended at -20°C/-80°C with minimal freeze-thaw cycles.

  • Poor protein purity:

    • Challenge: Contaminating proteins may co-purify with His-tagged Exig_2210.

    • Solution: Implement a multi-step purification strategy, beginning with IMAC and followed by size exclusion chromatography. Optimize washing conditions during IMAC by testing different imidazole concentrations for the wash buffer.

  • Inefficient solubilization:

    • Challenge: Extracting membrane proteins from the lipid bilayer while maintaining structure.

    • Solution: Screen multiple detergents (DDM, LDAO, OG) and detergent concentrations. Consider using newer amphipathic polymers like SMALPs that can extract membrane proteins with their native lipid environment.

Maintaining detailed records of expression conditions and outcomes will help identify optimal parameters for Exig_2210 production.

How can researchers troubleshoot issues with protein activity or structural integrity after reconstitution?

Troubleshooting protein activity or structural integrity issues after reconstitution of lyophilized Exig_2210 requires a systematic approach:

  • Assessment methods for structural integrity:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Intrinsic tryptophan fluorescence to assess tertiary structure

    • Size exclusion chromatography to detect aggregation

    • Dynamic light scattering (DLS) to measure particle size distribution

  • Common issues and solutions:

IssuePossible CausesTroubleshooting Approaches
Protein aggregationImproper reconstitution speed, unsuitable buffer- Reconstitute slowly at 4°C
- Test different buffer compositions
- Add stabilizing agents like trehalose
Loss of secondary structureDenaturation during lyophilization or reconstitution- Verify CD spectrum against reference
- Adjust pH or ionic strength
- Try different reconstitution methods
Reduced activityPartial denaturation or improper folding- Optimize reconstitution buffer
- Add proper cofactors if known
- Test different detergent types and concentrations
Inconsistent resultsSample heterogeneity- Improve purification protocol
- Use analytical SEC to isolate homogeneous fractions
- Standardize reconstitution procedure
  • Optimization strategies:

    • Reconstitute at different protein concentrations (0.1-1.0 mg/mL)

    • Test various glycerol concentrations (5-50%)

    • Evaluate different reconstitution temperatures (4°C vs. room temperature)

    • Consider reconstitution into liposomes or nanodiscs for functional studies

  • Quality control methods:

    • SDS-PAGE to verify protein integrity

    • Mass spectrometry to confirm exact molecular weight

    • Functional assays (if available) to assess activity

By systematically addressing these aspects, researchers can identify and resolve issues affecting Exig_2210's structural integrity and activity after reconstitution.

What strategies can researchers employ when facing issues with reproducibility in Exig_2210 characterization experiments?

Reproducibility challenges are common in membrane protein research. For Exig_2210 characterization experiments, consider these research-oriented strategies:

  • Standardization of protein preparation:

    • Document detailed protocols for expression, purification, and storage

    • Establish quality control criteria (purity >90% by SDS-PAGE)

    • Prepare large, homogeneous batches and store as single-use aliquots

    • Maintain consistent buffer compositions and storage conditions

  • Experimental design considerations:

    • Implement minimum of three independent biological replicates

    • Include technical replicates within each biological replicate

    • Use positive and negative controls in each experiment

    • Follow proper experimental design principles with clear independent and dependent variables

  • Data collection and analysis standardization:

    • Establish standard operating procedures (SOPs) for all characterization methods

    • Implement blinding procedures where appropriate

    • Use statistical methods appropriate for the experimental design

    • Document all data processing steps and parameters

  • Environmental factor control:

    • Maintain consistent laboratory temperature and humidity

    • Record batch numbers of all reagents and materials

    • Calibrate instruments regularly and document calibration

    • Consider circadian effects for time-sensitive experiments

  • Collaborative validation:

    • Exchange protocols and samples with collaborating laboratories

    • Implement inter-laboratory validation studies

    • Compare results using different but complementary techniques

A structured approach addressing these aspects can significantly improve reproducibility. When inconsistencies occur, systematic evaluation of each variable can help identify sources of variation and establish more robust experimental protocols.

How does the structure and function of Exig_2210 compare across Exiguobacterium strains from different extreme environments?

Comparative analysis of Exig_2210 across Exiguobacterium strains from diverse extreme environments reveals important adaptations that contribute to the organism's environmental versatility:

Exiguobacterium strains form two distinct phylogenetic divisions that generally correlate with their temperature growth ranges - psychrotrophic (cold-adapted) and thermophilic (heat-adapted) variants . This divergence provides an excellent model for studying how membrane proteins like Exig_2210 adapt to temperature extremes.

Key research findings and methodological considerations include:

  • Sequence variation analysis:

    • Multiple sequence alignment of Exig_2210 homologs from different strains

    • Identification of conserved domains versus variable regions

    • Correlation of sequence variations with environmental adaptation

  • Structural adaptations:

    • Cold-adapted variants typically show increased flexibility (more glycine residues, fewer proline and arginine residues)

    • Heat-adapted variants often display enhanced stability (more ionic interactions, hydrophobic packing)

    • Comparative modeling to visualize structural differences

  • Functional divergence:

    • Expression level variations across temperature gradients

    • Potential differences in protein-protein interactions

    • Altered membrane localization or topology

  • Experimental approaches:

    • Recombinant expression of Exig_2210 variants from different strains

    • Comparative biochemical characterization (stability, activity)

    • Site-directed mutagenesis to introduce adaptive mutations between variants

  • Genomic context comparison:

    • Analysis of genomic neighborhood conservation

    • Identification of co-evolving genes

    • Examination of regulatory elements controlling expression

Researchers should implement a systematic comparative approach, expressing and characterizing Exig_2210 variants from psychrotrophic strains (e.g., Siberian permafrost isolates) and thermophilic strains (e.g., Yellowstone hot spring isolates) to identify specific adaptations that enable function across extreme temperature ranges .

What advanced biophysical techniques are most informative for characterizing the dynamics of Exig_2210 in membrane environments?

For comprehensive characterization of Exig_2210 dynamics in membrane environments, researchers should employ these advanced biophysical techniques:

  • Solid-state NMR spectroscopy:

    • Allows studies of membrane proteins in lipid bilayers

    • Provides information on protein dynamics at different timescales

    • Can measure order parameters for specific residues

    • Methodology requires isotopically labeled protein (15N, 13C) reconstituted in model membranes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps solvent accessibility and conformational dynamics

    • Identifies flexible regions and potential binding interfaces

    • Experimental design involves time-resolved deuterium labeling followed by MS analysis

    • Particularly valuable for comparing dynamics between Exig_2210 variants from psychrophilic and thermophilic strains

  • Single-molecule FRET:

    • Measures distances between specific labeled sites

    • Detects conformational subpopulations not apparent in ensemble measurements

    • Tracks protein dynamics in real-time

    • Requires site-specific incorporation of fluorophores via cysteine chemistry or unnatural amino acids

  • Molecular dynamics (MD) simulations:

    • Predicts protein behavior in different membrane environments

    • Models response to temperature, pH, or other environmental factors

    • Identifies potential conformational changes

    • Can be validated using experimental data from other techniques

  • Neutron reflectometry and scattering:

    • Determines protein orientation and penetration depth in membranes

    • Provides structural information in near-native conditions

    • Offers contrast between protein and lipid components

    • Requires specialized neutron sources and deuterated materials

An integrated approach combining multiple techniques provides the most comprehensive view of Exig_2210 dynamics. For example, MD simulations could generate hypotheses about temperature-dependent conformational changes that could then be tested experimentally using HDX-MS and solid-state NMR. This multi-technique strategy is particularly valuable for understanding how membrane protein dynamics contribute to extremophile adaptations.

How might researchers design experiments to elucidate the potential role of Exig_2210 in stress response pathways of Exiguobacterium sibiricum?

Designing experiments to elucidate Exig_2210's role in stress response requires a comprehensive approach combining genetic, biochemical, and systems biology methods:

  • Gene expression analysis under stress conditions:

    • Experimental design: Expose Exiguobacterium sibiricum cultures to various stressors (temperature extremes, pH shifts, osmotic stress, oxidative stress)

    • Methodology: Quantitative RT-PCR and RNA-seq to measure exig_2210 expression changes

    • Controls: Include housekeeping genes and known stress-response genes

    • Data analysis: Correlation of expression patterns with specific stressors

  • Genetic manipulation approaches:

    • Gene knockout/knockdown: Generate exig_2210 deletion or silencing mutants

    • Complementation studies: Reintroduce wild-type or mutant versions

    • Stress susceptibility assays: Compare growth and survival of mutants versus wild-type under stress conditions

    • Experimental design considerations: Minimum three biological replicates, multiple stress intensities, time-course measurements

  • Protein interaction network mapping:

    • Pull-down assays: Use His-tagged Exig_2210 to identify interacting proteins

    • Comparative analysis: Map interactions under normal versus stress conditions

    • Validation: Confirm key interactions using orthogonal methods (FRET, SPR)

    • Network analysis: Identify connections to known stress response pathways

  • Physiological characterization:

    • Membrane integrity assays: Compare wild-type and mutant strains under stress

    • Bioenergetic measurements: Assess membrane potential, ATP production

    • Metabolomic analysis: Identify metabolic shifts associated with Exig_2210 activity

    • Design considerations: Include appropriate controls, standardize growth conditions

  • Structural response to stress:

    • In situ labeling: Monitor Exig_2210 conformational changes under stress

    • Crosslinking studies: Identify stress-induced interaction changes

    • Localization studies: Track protein redistribution during stress response

    • Controls: Include other membrane proteins for comparison

The experimental design should follow a logical progression from establishing correlation (expression changes during stress) to demonstrating causation (phenotypic effects of gene manipulation) to elucidating mechanisms (interaction networks and structural changes). This comprehensive approach can reveal how Exig_2210 contributes to the remarkable stress adaptability of Exiguobacterium sibiricum across diverse extreme environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.