Recombinant Exiguobacterium sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Exiguobacterium sp. Large-Conductance Mechanosensitive Channel (MscL)

Recombinant Exiguobacterium sp. Large-conductance mechanosensitive channel (MscL) refers to a mechanosensitive ion channel derived from the bacterium Exiguobacterium and produced using recombinant DNA technology . MscL channels are integral membrane proteins that respond to mechanical stimuli, such as changes in membrane tension, by opening a pore that allows ions to flow across the cell membrane . These channels are found in bacteria, archaea, and eukaryotes, where they play a crucial role in osmoregulation and protection against hypoosmotic shock. The Exiguobacterium genus is known for its ability to survive in diverse and extreme environments, and some species have demonstrated antibiotic properties .

Characteristics of Exiguobacterium Species

Exiguobacterium is a genus of bacteria within the phylum Firmicutes and the family Bacillaceae . These bacteria are known for their adaptability to various environments, including marine sediments and extreme conditions . Some Exiguobacterium species produce pigments with antibacterial properties, making them potentially useful in controlling food-borne pathogens .

Key characteristics of Exiguobacterium species:

  • Adaptability to diverse environments

  • Production of pigments with antibacterial properties

  • Presence of antibiotic resistance genes

  • Potential for producing novel peptide-based compounds

Role and Function of Mechanosensitive Channels (MscL)

Mechanosensitive channels like MscL are essential for maintaining cellular homeostasis in response to mechanical stress . They act as emergency release valves, opening when membrane tension increases to prevent cell lysis due to osmotic shock.

Key functions of MscL channels:

  • Osmoregulation: Protect cells from swelling and bursting in hypoosmotic conditions.

  • Mechanical Stress Response: Respond to changes in membrane tension caused by external forces.

  • Ion Transport: Facilitate the flow of ions across the cell membrane upon activation.

Recombinant Production of Exiguobacterium sp. MscL

The production of recombinant Exiguobacterium sp. MscL involves using genetic engineering techniques to express the MscL protein in a host organism, such as E. coli . This allows for the production of large quantities of the protein for research and industrial applications.

Steps in recombinant production:

  1. Gene Cloning: The gene encoding MscL from Exiguobacterium is isolated and cloned into an expression vector.

  2. Transformation: The expression vector is introduced into a host organism (E. coli).

  3. Protein Expression: The host organism is cultured under conditions that promote the expression of the MscL protein.

  4. Purification: The MscL protein is isolated and purified from the host cell lysate.

Applications and Research Findings

Recombinant Exiguobacterium sp. MscL has several potential applications in biotechnology and medicine. Its ability to respond to mechanical stimuli makes it a valuable tool for developing biosensors and drug delivery systems.

Potential applications and research findings:

  • Drug Discovery: MscL channels can be used as targets for developing new drugs that modulate their activity.

  • Biosensors: MscL channels can be incorporated into biosensors to detect mechanical stress or changes in membrane tension.

  • Antimicrobial Research: Studying MscL channels in Exiguobacterium can provide insights into the mechanisms of antibiotic resistance and potential new antimicrobial compounds .

  • Structural Biology: Recombinant production allows for detailed structural studies of MscL channels, leading to a better understanding of their function .

Antibiotic Properties of Exiguobacterium sp.

Some Exiguobacterium species exhibit antibiotic properties against various bacteria . For instance, Exiguobacterium sp. RIT 452 has shown activity against both Gram-positive and Gram-negative bacteria . Additionally, pigments produced by Exiguobacterium sp. GM010 have demonstrated antibacterial effects against food-borne pathogens .

Key findings on antibiotic properties:

  • Exiguobacterium sp. RIT 452 produces compounds that inhibit the growth of E. coli, P. aeruginosa, B. subtilis, and S. aureus .

  • Pigments from Exiguobacterium sp. GM010 disrupt the cell membrane integrity of food-borne pathogens .

  • Exiguobacterium sp. S3-2 exhibits resistance to multiple antibiotics due to genes located on a mosaic plasmid .

Tables and Data

Table 1: Minimal Inhibitory Concentration (MIC) and Minimal Bactericidal Concentration (MBC) of Exiguobacterium sp. GM010 Pigment Against Food-Borne Pathogens

Food-Borne PathogenMIC (μg/ml)MBC (μg/ml)
L. monocytogenes Scott A62.5125
M. luteus ATCC 934162.5125
Klebsiella sp250500
P. aeruginosa ATCC 15442250500
E. coli EFR025001000

Table 2: Antibiotic Resistance of Exiguobacterium sp. Strain S3-2

AntibioticMIC (mg/liter)
Trimethoprim-sulfamethoxazole>1,024
Chloramphenicol32
Tetracycline16
Streptomycin128
Erythromycin8

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
mscL; EAT1b_1294; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Target Names
mscL
Target Protein Sequence
MWKEFKKFAMRGNVIDLAVAVVLGAAFTAIVNSLVNDIFMPLLGIIIGGIDFSSLKASIL GVDVLYGNFIQQIVSFFLIAIALFLIVKVINRLQREKEVEEAAIPTPTKEEQLLTEIRDL LKDRSL
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the large-conductance mechanosensitive channel (mscL) and what is its role in Exiguobacterium sp.?

The large-conductance mechanosensitive channel (mscL) is a membrane protein that forms a non-selective channel which opens in response to increased membrane tension. In bacteria such as Exiguobacterium sp., mscL serves as a critical adaptation mechanism during osmotic downshock, when cells transition from high to low osmolarity environments .

When bacterial cells experience sudden osmotic downshock, water rapidly enters the cell, increasing turgor pressure. Without a release mechanism, this increased pressure would lead to cell lysis. MscL channels respond by opening at pressure thresholds just below those that would compromise cell integrity, allowing the rapid efflux of cytoplasmic solutes and preventing cell rupture .

In Exiguobacterium sp., which inhabits diverse environments including extreme conditions such as high altitudes, hot springs, and permafrost, mscL likely plays a particularly important role in adapting to fluctuating environmental conditions . Unlike many other stress-resistant bacteria, Exiguobacterium does not form spores, suggesting that mechanisms like mscL channels may be especially crucial for its environmental adaptability .

What are the general approaches for recombinant expression of mechanosensitive channels?

Recombinant expression of mechanosensitive channels typically involves the following methodological approaches:

  • Cloning strategy: The mscL gene must be amplified from genomic DNA using specific primers designed based on the Exiguobacterium sp. genome sequence. PCR products are then cloned into appropriate expression vectors.

  • Expression system selection: E. coli is commonly used for recombinant membrane protein expression. Expression strains like BL21(DE3), C41(DE3), or C43(DE3) are often preferred as they're optimized for membrane protein production.

  • Expression vector choice: Vectors containing inducible promoters (like T7 or araBAD) allow controlled expression. Adding affinity tags (His6, FLAG, etc.) facilitates purification.

  • Expression conditions: Optimization involves testing different temperatures (often lower temperatures like 18-25°C improve folding), induction times, and inducer concentrations.

  • Membrane extraction: Cells are typically disrupted by sonication or French press, followed by differential centrifugation to isolate membrane fractions.

  • Protein solubilization: Detergents like n-dodecyl-β-D-maltopyranoside (DDM), octyl glucoside, or CHAPS are used to extract membrane proteins.

  • Purification: Affinity chromatography (using the added tag), followed by size exclusion chromatography to obtain pure, homogeneous protein.

For Exiguobacterium sp. mscL specifically, expression conditions may need further optimization considering the extremophilic nature of the source organism .

How can functional assays be designed to evaluate recombinant Exiguobacterium sp. mscL activity?

Functional characterization of recombinant Exiguobacterium sp. mscL can be performed using several complementary approaches:

  • Patch-clamp electrophysiology: This gold standard technique directly measures channel activity. Recombinant protein can be reconstituted into liposomes or expressed in giant bacterial spheroplasts for patch-clamping. Key parameters to measure include:

    • Pressure threshold for channel opening

    • Single-channel conductance (expected to be around 3 nS based on other mscL channels)

    • Channel gating kinetics

    • Ion selectivity

  • Growth complementation assays: E. coli strains lacking endogenous mechanosensitive channels (e.g., MJF455 strain lacking both mscL and yggB) show severely compromised viability upon osmotic downshock . Complementation with Exiguobacterium sp. mscL can be assessed by measuring:

    • Cell survival rates after different magnitudes of osmotic downshock

    • Growth recovery times following osmotic stress

  • Fluorescence-based assays: Utilizing fluorescent probes that are released upon channel opening:

    • Calcein-loaded liposomes containing reconstituted mscL will release the dye upon pressure application

    • FRET-based assays can monitor conformational changes during channel gating

  • Solute release measurements: Measuring the efflux of cellular solutes like potassium ions using appropriate probes or electrodes can provide quantitative data on channel function during osmotic transitions .

A comprehensive experimental design would include controls such as non-functional mscL mutants and comparison with well-characterized mscL from E. coli or M. tuberculosis.

What structural and functional modifications could be engineered in Exiguobacterium sp. mscL to tune its mechanosensitivity for specific research applications?

Engineering Exiguobacterium sp. mscL for modified mechanosensitivity can be approached through several targeted strategies:

  • Hydrophobic pore residue modifications: The hydrophobic pore constriction can be altered through site-directed mutagenesis. For example:

    • Substituting key hydrophobic residues with more polar amino acids typically lowers gating threshold

    • Converting specific residues to cysteines allows chemical modification with charged reagents for gating control

  • Transmembrane domain engineering: The transmembrane helices contain periodic glycine residues critical for channel gating . Modifications could include:

    • Altering glycine patterns to change helix flexibility

    • Introducing residues that affect helix-helix packing

  • C-terminal domain modifications: This domain influences channel clustering and may modulate gating behavior:

    • Truncations or specific mutations can alter channel sensitivity

    • Fusion with regulatory domains can create chemically-controllable channels

  • Membrane interface alterations: Changing residues at the membrane-water interface can affect how tension is sensed:

    • Modifying charged residues in this region can shift the voltage-dependence

    • Altering hydrophobic residues can change lipid interactions and tension sensitivity

A methodical approach would involve creating a library of variants using site-directed mutagenesis, followed by functional characterization using patch-clamp analysis and in vivo assays. The following table outlines potential engineering targets and their expected effects:

Engineering TargetSpecific ModificationsExpected Functional EffectApplication
Pore constrictionL→Q, V→D substitutionsDecreased opening thresholdBiosensors with enhanced sensitivity
Transmembrane glycinesG→A or G→L substitutionsAltered gating tension thresholdFine-tuning for specific osmotic responses
Cytoplasmic domainC-terminal truncationsModified clustering behaviorControlled oligomerization for measurement applications
Membrane interfaceCharged residue modificationsAltered membrane tension sensingAdaptation to specific lipid environments

These engineering approaches could yield mscL variants suitable for applications such as controlled substance release in liposomes, biosensors for mechanical force, or cellular osmoregulation systems .

What are the optimal conditions for reconstituting purified recombinant Exiguobacterium sp. mscL into proteoliposomes for functional studies?

Reconstitution of purified recombinant Exiguobacterium sp. mscL into proteoliposomes requires careful optimization of multiple parameters:

  • Lipid composition: The lipid environment significantly affects mechanosensitive channel function:

    • A mixture of phosphatidylethanolamine (PE), phosphatidylglycerol (PG), and phosphatidylcholine (PC) in ratios mimicking bacterial membranes (typically 7:2:1) provides a good starting point

    • For Exiguobacterium sp. mscL, which comes from an extremophile, incorporating specific lipids from the native organism may improve functionality

    • Cholesterol content (0-20%) can be varied to modulate membrane fluidity and thickness

  • Protein-to-lipid ratio: This critical parameter affects channel density and liposome stability:

    • Initial screening with ratios from 1:50 to 1:2000 (w/w) is recommended

    • Lower ratios (more protein) facilitate electrophysiological measurements

    • Higher ratios (less protein) reduce the chance of non-specific effects

  • Reconstitution method:

    • Detergent removal by dialysis: Slow removal preserves protein structure but takes 2-3 days

    • Bio-beads adsorption: Faster (4-12 hours) but may affect some protein conformations

    • Dilution method: Simple but yields heterogeneous liposomes

  • Buffer conditions:

    • pH optimization (typically 6.5-8.0)

    • Ionic strength (100-300 mM salt)

    • Addition of osmolytes or stabilizers for the extremophilic protein

  • Proteoliposome size control:

    • Extrusion through polycarbonate filters (100-400 nm) creates uniform-sized liposomes

    • Sonication produces smaller vesicles but may damage protein

A systematic optimization approach can be designed as follows:

ParameterVariables to TestAnalytical MethodExpected Outcome Measure
Lipid compositionPE:PG:PC ratios, Native lipidsPatch-clamp, Calcein releaseChannel gating pressure threshold
Protein:lipid ratio1:50 to 1:2000 (w/w)Freeze-fracture EM, SDS-PAGEProtein incorporation efficiency
Reconstitution methodDialysis vs. Bio-beads vs. DilutionDynamic light scatteringProteoliposome size distribution
Buffer conditionspH 6.5-8.0, Salt 100-300 mMCircular dichroismProtein structural integrity
Temperature4°C, 25°C, 37°CActivity assaysFunctional channel formation

For Exiguobacterium sp. mscL specifically, considering its environmental adaptability, testing reconstitution at different temperatures and pH conditions that reflect its natural habitat would be particularly important .

How can we resolve experimental challenges when comparing mscL function across different bacterial species like Exiguobacterium and E. coli?

Comparing mechanosensitive channel function across different bacterial species presents several experimental challenges that require careful methodological approaches:

  • Differential expression levels:

    • Challenge: Native expression levels of mscL may vary significantly between species

    • Solution: Quantitative proteomics (SRM/MRM MS) to determine absolute copy numbers per cell

    • Application: Normalize functional data to protein abundance for fair comparisons

  • Membrane composition differences:

    • Challenge: Exiguobacterium sp. as an extremophile likely has a distinct membrane composition compared to E. coli

    • Solution: Lipidomic analysis of native membranes followed by reconstitution in both native-like and standardized lipid environments

    • Experimental approach: Compare channel function in native membranes versus defined reconstituted systems

  • Physiological context variations:

    • Challenge: Different osmotic shock thresholds between species due to varying environmental adaptations

    • Solution: Develop standardized osmotic shock protocols calibrated to each species' physiological range

    • Method: Generate percent survival curves across a range of osmotic downshock magnitudes for each species

  • Genetic background interference:

    • Challenge: Other channels or compensatory mechanisms may mask specific mscL contributions

    • Solution: Cross-species complementation (expressing Exiguobacterium mscL in E. coli mscL/yggB mutants)

    • Analysis: Quantify restoration of survival during osmotic downshock

  • Technical measurement standardization:

    • Challenge: Variations in patch-clamp configurations and pressure application systems

    • Solution: Develop internal calibration standards and normalized reporting of gating parameters

    • Approach: Express pressure thresholds as ratios to lytic pressure rather than absolute values

The following experimental workflow addresses these challenges systematically:

  • Create expression constructs for both species' mscL genes with identical regulatory elements and tags

  • Express in the same host (E. coli MJF455 lacking endogenous channels)

  • Perform parallel functional characterization:

    • Patch-clamp analysis in spheroplasts or reconstituted systems

    • Osmotic survival assays with standardized downshock protocols

    • Solute release measurements during controlled osmotic transitions

This approach enables direct functional comparison while controlling for expression level, genetic background, and measurement variables.

What experimental evidence would be required to elucidate the relationship between Exiguobacterium sp. environmental adaptability and its mechanosensitive channel properties?

Establishing the relationship between Exiguobacterium sp. environmental adaptability and its mechanosensitive channel properties requires a multifaceted experimental approach:

  • Comparative genomics and evolutionary analysis:

    • Sequence mechanosensitive channel genes from multiple Exiguobacterium strains isolated from diverse environments (hot springs, permafrost, high-altitude salt plains)

    • Perform phylogenetic analysis to correlate sequence variations with habitat conditions

    • Identify specific amino acid residues under positive selection in different environments

  • Environmental stress response profiling:

    • Challenge Exiguobacterium strains with various stressors (temperature, osmolarity, pH)

    • Measure mscL expression levels using qRT-PCR and proteomics

    • Correlate expression patterns with adaptation to specific environmental conditions

    • Test hypothesis: Does mscL upregulation compensate for lack of spore formation in stress response?

  • Structure-function analysis of environmental variants:

    • Express and purify mscL from Exiguobacterium strains adapted to different environments

    • Characterize channel properties using patch-clamp electrophysiology

    • Measure key parameters such as:

      • Pressure threshold for activation

      • Conductance and ion selectivity

      • Temperature dependence of gating

      • pH sensitivity of channel function

  • In vivo significance testing:

    • Create mscL knockout mutants in different Exiguobacterium strains

    • Assess survival rates under various environmental stresses

    • Perform complementation studies with mscL variants from different environmental isolates

    • Test cross-species complementation with mechanosensitive channels from non-extremophiles

  • Molecular dynamics simulations:

    • Model Exiguobacterium mscL behavior under different environmental conditions

    • Compare simulated responses to experimental findings

    • Identify specific structural adaptations that contribute to environmental resilience

A comprehensive experimental dataset would include the following elements:

Experimental ApproachKey MeasurementsExpected OutcomesRelationship to Adaptability
Comparative genomicsSequence variation analysisIdentification of conserved vs. variable regionsCorrelation with environmental niches
Expression analysismscL transcript/protein levelsStress-specific expression patternsRole in stress response network
ElectrophysiologyGating threshold, conductanceChannel functional parametersAdaptation to specific environmental pressures
Mutant phenotypingSurvival under stress conditionsFitness contributionsQuantification of mscL importance
Cross-complementationFunctional restorationSpecies-specific vs. universal propertiesDegree of specialized adaptation

This integrated approach would provide robust evidence for how Exiguobacterium sp. mechanosensitive channels contribute to its remarkable environmental adaptability without relying on spore formation as a stress response mechanism .

What are the recommended protocols for isolating and cloning the mscL gene from Exiguobacterium sp.?

Isolating and cloning the mscL gene from Exiguobacterium sp. requires a systematic approach that addresses the unique characteristics of this extremophilic bacterium:

  • Strain selection and cultivation:

    • Select appropriate Exiguobacterium strain based on research goals (e.g., RIT452 has been well-characterized genomically)

    • Culture using appropriate media (Tryptic Soy Broth or LB) at optimal growth temperature (typically 30°C for most strains)

    • Consider stress preconditioning to upregulate mechanosensitive channel expression

  • Genomic DNA extraction:

    • Method must accommodate the Gram-positive cell wall of Exiguobacterium

    • Recommended protocol:

      • Grow cells to late exponential phase in 3-5 mL media

      • Harvest by centrifugation (5000 × g, 10 min)

      • Resuspend in lysis buffer containing lysozyme (10 mg/mL) and incubate at 37°C for 30 minutes

      • Add proteinase K and SDS for complete lysis

      • Extract DNA using phenol-chloroform or commercial kits optimized for Gram-positive bacteria

  • PCR amplification strategy:

    • Design primers based on available Exiguobacterium genome sequences

    • For novel strains, use degenerate primers targeting conserved regions of mscL

    • Recommended PCR conditions:

      • High-fidelity DNA polymerase (Q5 or Phusion)

      • Initial denaturation: 98°C, 3 min

      • 30 cycles: 98°C 10s, 55-65°C 30s, 72°C 30s

      • Final extension: 72°C, 5 min

    • Include appropriate restriction sites or overhangs for subsequent cloning

  • Cloning strategy options:

    • Restriction enzyme-based cloning:

      • Select restriction sites absent in the mscL sequence

      • Digest PCR product and vector with compatible enzymes

      • Ligate using T4 DNA ligase at 16°C overnight

    • Gibson Assembly:

      • Design primers with 20-25 bp overlaps to destination vector

      • Incubate PCR product and linearized vector with Gibson Assembly master mix (1 hour at 50°C)

    • TOPO or other commercial systems:

      • Use vectors specifically designed for membrane protein expression

  • Sequence verification:

    • Perform Sanger sequencing of the entire insert

    • Compare with reference sequences and check for PCR-introduced errors

    • Verify correct reading frame and absence of premature stop codons

The workflow can be optimized based on specific research requirements:

Research GoalCloning StrategyVector SelectionExpression System
Functional studiesNative sequencepET or pBAD seriesE. coli C41/C43
Structural analysisAdd purification tagpET28 (His-tag)E. coli BL21(DE3)
Mutagenesis studiesInclude flanking regionspHSG575 (low copy)Controlled expression
Comparative analysisMultiple strain variantsGateway systemParallel processing

For Exiguobacterium sp., consider potential challenges such as codon usage bias, expression toxicity, and protein folding issues that might require specialized optimization strategies beyond standard cloning procedures.

How can researchers effectively analyze the structure-function relationship of recombinant Exiguobacterium sp. mscL using computational and experimental approaches?

Elucidating the structure-function relationship of recombinant Exiguobacterium sp. mscL requires an integrated computational and experimental approach:

  • Computational structural analysis:

    • Homology modeling:

      • Use M. tuberculosis mscL crystal structure as template (PDB: 2OAR)

      • Employ multiple modeling platforms (SWISS-MODEL, I-TASSER, AlphaFold)

      • Validate models through energy minimization and Ramachandran plot analysis

    • Molecular dynamics simulations:

      • Embed model in lipid bilayer mimicking Exiguobacterium membrane

      • Simulate membrane tension to observe channel gating

      • Analyze key conformational changes during tension-induced opening

  • Site-directed mutagenesis guided by computational predictions:

    • Target conserved glycine residues in transmembrane domains

    • Focus on pore-lining residues identified through computational analysis

    • Create systematic alanine scanning library of transmembrane domains

    • Develop mutations specifically targeting unique residues in Exiguobacterium mscL

  • Experimental structural characterization:

    • X-ray crystallography:

      • Express protein with fusion partners to aid crystallization

      • Screen detergents and lipidic cubic phase formulations

      • Attempt crystallization in both closed and open states

    • Cryo-electron microscopy:

      • Prepare proteoliposomes or nanodiscs with embedded mscL

      • Image in different conformational states

      • Perform 3D reconstruction at sub-4Å resolution

    • Spectroscopic methods:

      • FRET analysis with strategically placed fluorophores

      • EPR spectroscopy with spin labels to track conformational changes

      • Solid-state NMR to analyze membrane interactions

  • Functional correlations with structural elements:

    • Electrophysiological characterization of mutants:

      • Patch-clamp analysis of channel conductance and gating

      • Pressure threshold determination for each variant

      • Ion selectivity measurements

    • In vivo functional assays:

      • Osmotic downshock survival testing of mutant channels

      • Solute release measurements during controlled pressure application

      • Growth phenotypes under varying osmotic conditions

The following research pipeline integrates these approaches:

StageComputational MethodsExperimental MethodsIntegration Points
Initial structure predictionHomology modeling-Identification of key structural elements
Hypothesis generationMD simulations of tension response-Prediction of critical residues and movements
Targeted mutationsIn silico mutagenesisSite-directed mutagenesisTesting computational predictions
Structural validationModel refinementCryo-EM or X-ray structuresIterative improvement of models
Functional correlationSimulation of mutant behaviorPatch-clamp analysisStructure-function relationships
Mechanism elucidationTransition pathway modelingFRET/EPR distance measurementsMolecular mechanism of gating

This integrated approach provides multiple lines of evidence to understand how Exiguobacterium sp. mscL structural features contribute to its functional properties, particularly any adaptations that might be related to the extremophilic nature of the organism .

What are the best experimental approaches to investigate the potential biotechnological applications of recombinant Exiguobacterium sp. mscL?

Investigating biotechnological applications of recombinant Exiguobacterium sp. mscL requires systematic evaluation of its unique properties and potential advantages over other mechanosensitive channels:

  • Controlled release system development:

    • Liposome-based delivery platforms:

      • Incorporate recombinant mscL into liposomes containing model compounds

      • Characterize release kinetics under controlled pressure applications

      • Compare with other mscL variants for release efficiency and control

    • Experimental methodology:

      • Prepare calcein-loaded liposomes with incorporated mscL

      • Apply defined osmotic gradients or direct pressure

      • Measure fluorescence dequenching as indicator of release

      • Quantify release rates and pressure thresholds

  • Biosensor development:

    • Pressure/tension sensing applications:

      • Engineer mscL variants with fluorescent reporters that indicate open/closed states

      • Calibrate response to defined pressure inputs

      • Test sensitivity, dynamic range, and response time

    • Implementation strategies:

      • FRET-based sensors with fluorescent proteins at key locations

      • Electrical biosensors measuring conductance changes

      • Microfluidic devices with integrated sensing elements

  • Environmental adaptation studies:

    • Extremophilic properties exploitation:

      • Characterize temperature, pH, and solvent stability of Exiguobacterium mscL

      • Compare with mesophilic mechanosensitive channels

      • Identify specific adaptations conferring enhanced stability

    • Application-focused testing:

      • Function retention under industrial conditions

      • Long-term stability in potential delivery formulations

      • Activity in non-physiological environments

  • Protein engineering for specific applications:

    • Rational design approaches:

      • Modify gating threshold through targeted mutations

      • Engineer ligand-gated variants through domain fusion

      • Create chimeric channels with specialized properties

    • High-throughput screening:

      • Develop selection systems for desired properties

      • Screen mutant libraries using fluorescence-based assays

      • Evolve application-specific variants through directed evolution

The following table outlines specific experimental protocols for evaluating biotechnological potential:

Application CategoryExperimental ApproachKey MeasurementsSuccess Metrics
Drug delivery systemsLiposome release assaysRelease rates, pressure sensitivityControllable release, stability in serum
Biosensing platformsFluorescent reporter integrationSignal-to-noise ratio, detection limitSensitivity compared to existing sensors
Industrial enzymesStability in harsh conditionsActivity retention after stressSuperior performance vs. conventional channels
Synthetic biology toolsGenetic circuit integrationResponse dynamics, orthogonalityFunctionality in cellular context

For each application, comparative analysis with existing technologies is essential to identify the unique advantages conferred by the extremophilic origin of Exiguobacterium sp. mscL .

What are common challenges in recombinant expression of Exiguobacterium sp. mscL and how can they be overcome?

Recombinant expression of membrane proteins like Exiguobacterium sp. mscL presents several challenges that require specific troubleshooting approaches:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for expression host

      • Test multiple promoter strengths (T7, tac, araBAD)

      • Screen expression strains (BL21, C41/C43, Lemo21)

      • Use fusion partners (MBP, SUMO, Mistic) to enhance expression

      • Lower induction temperature (16-20°C) to slow expression rate

    • Diagnostic approach: Western blotting with anti-tag antibodies to detect even low expression levels

  • Protein toxicity:

    • Challenge: Overexpression of mechanosensitive channels can disrupt host membrane integrity

    • Solutions:

      • Use tight expression control with glucose repression for leaky promoters

      • Employ low-copy number vectors (pHSG575)

      • Add osmotic stabilizers to growth media

      • Consider cell-free expression systems

    • Implementation: Monitor growth curves after induction to identify toxic effects

  • Improper folding/aggregation:

    • Challenge: Inclusion body formation or misfolded protein

    • Solutions:

      • Express at lower temperatures with slower induction rates

      • Co-express with chaperones (GroEL/ES, DnaK/J)

      • Add specific lipids to growth media

      • Consider native-like detergents early in extraction process

    • Analysis: Compare membrane fraction vs. inclusion body presence by fractionation and SDS-PAGE

  • Poor extraction efficiency:

    • Challenge: Inefficient solubilization from membranes

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, FC-12, CHAPS)

      • Optimize detergent:protein ratio

      • Test extraction time and temperature

      • Consider styrene maleic acid lipid particles (SMALPs) for native-like extraction

    • Protocol refinement: Monitor protein in membrane, soluble, and insoluble fractions during extraction

  • Loss of function:

    • Challenge: Expressed protein lacks activity

    • Solutions:

      • Verify sequence integrity

      • Ensure proper membrane targeting (check with GFP fusion analysis)

      • Test multiple purification strategies to maintain native structure

      • Reconstitute in lipids mimicking Exiguobacterium membranes

    • Functional verification: Patch-clamp or liposome-based activity assays

The following troubleshooting decision tree can guide optimization:

Problem ObservedFirst Diagnostic StepPrimary StrategyAlternative ApproachVerification Method
No detectable expressionWestern blot analysisChange expression strainOptimize vector/promoterImmunofluorescence microscopy
Expression but in inclusion bodiesFractionation analysisLower temperature, slower inductionCo-express chaperonesMembrane isolation and analysis
Membrane expression but no extractionDetergent screeningTest multiple detergent classesUse membrane scaffold proteinsSDS-PAGE of extracted fraction
Extraction but inactive proteinActivity assaysReconstitution optimizationStructure stabilizationPatch-clamp or fluorescence assays

Special considerations for Exiguobacterium sp. mscL include accounting for its extremophilic origin - expression conditions may need to reflect aspects of its native environment for optimal folding and function .

How can researchers distinguish between the activities of different mechanosensitive channels when studying recombinant Exiguobacterium sp. mscL?

Distinguishing between different mechanosensitive channel activities requires careful experimental design and specific analytical approaches:

  • Genetic approaches for isolation of specific channel activity:

    • Expression in knockout backgrounds:

      • Use E. coli strains with deleted endogenous mechanosensitive channels (e.g., MJF465 lacking mscL, yggB, and kefA)

      • Express recombinant Exiguobacterium sp. mscL in these backgrounds

      • Any observed channel activity can be attributed specifically to the expressed channel

    • Complementation analysis:

      • Test ability of Exiguobacterium sp. mscL to rescue osmotic shock sensitivity

      • Compare complementation efficiency with other mechanosensitive channels

  • Electrophysiological discrimination:

    • Channel conductance analysis:

      • Different mechanosensitive channels have characteristic conductance values

      • MscL typically has higher conductance (~3 nS) compared to MscS (~1 nS)

      • Record single-channel currents at different voltages

    • Gating characteristics:

      • Analyze pressure threshold differences (MscL requires greater tension than MscS)

      • Observe desensitization patterns (MscS shows desensitization while KefA-like channels remain open under extended pressure)

      • Measure dwell times in open/closed states

  • Pharmacological tools:

    • Selective inhibitors:

      • Screen for compounds that selectively block specific channel types

      • Use gadolinium ions (Gd³⁺) which affect different channels with varying potency

      • Apply membrane-active amphipaths that differentially impact channel types

    • Modulation analysis:

      • Test effect of pH on different channel types

      • Examine differences in response to membrane-active compounds

  • Biophysical differentiation:

    • Reconstitution in defined systems:

      • Purify individual channel types and reconstitute in liposomes

      • Perform side-by-side comparative analysis

      • Use fluorescent tracers with different molecular weights to assess pore size

    • Structural probes:

      • Apply site-specific labels to distinguish channel types

      • Use specific antibodies against unique epitopes

The following analytical framework helps distinguish channel activities:

Channel PropertyMscLMscS (YggB)KefA-likeExperimental Approach
Conductance~3 nS~1 nS~1 nSPatch-clamp single channel recordings
Pressure thresholdHigherLowerVariableNegative pressure application during patch-clamp
DesensitizationMinimalRapid (seconds)Sustained activity (minutes)Extended pressure application
Ion selectivityNon-selectiveSlight anion preferenceChannel-specificIon substitution experiments
Pore sizeLargerSmallerIntermediateSizing via permeant molecules

To specifically isolate Exiguobacterium sp. mscL activity:

  • Express in MJF465 strain lacking all major mechanosensitive channels

  • Perform patch-clamp analysis looking for MscL-like conductance and pressure threshold

  • Compare properties with well-characterized MscL from E. coli or M. tuberculosis

  • Use specific antibodies against Exiguobacterium sp. mscL to confirm expression

This systematic approach enables clear attribution of observed channel activities to specific recombinant channels rather than endogenous mechanosensitive channels or other membrane phenomena.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.