Recombinant Exiguobacterium sp. UPF0316 protein EAT1b_0871 (EAT1b_0871)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its development.
Synonyms
EAT1b_0871; UPF0316 protein EAT1b_0871
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Target Names
EAT1b_0871
Target Protein Sequence
MGQILLILLLQLIYVPVLTLRTIMLVKGKTVIAGLFGTLETLIYIFALGIVFQDLTTVGM IVYAVGFGLGILLGGFVERKLAIGYNMIQVHTKEYPAELIQQMRDNGYGVTHYQGQGRDG VRYRLDVLAARTRMKELRELVEKHEPKAFLVAFDPIDFKGGYMMKGLRRPK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for maintaining EAT1b_0871 protein stability?

For optimal stability of recombinant EAT1b_0871 protein, store the lyophilized powder at -20°C/-80°C for extended periods (up to 12 months). For the reconstituted protein in liquid form, stability is maintained for approximately 6 months at -20°C/-80°C when stored in aliquots with 50% glycerol as a cryoprotectant. Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they significantly decrease protein activity .

To maximize stability:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended)

  • Prepare small single-use aliquots to prevent repeated freeze-thaw cycles

What expression systems have been validated for producing functional recombinant EAT1b_0871 protein?

Multiple expression systems have been validated for the recombinant production of EAT1b_0871 protein, each with distinct advantages:

Expression SystemTagPurityAdvantagesApplications
E. coliN-terminal His>90% (SDS-PAGE)High yield, cost-effective, rapid productionStructural studies, antibody generation
BaculovirusVariable*>85% (SDS-PAGE)Better folding, post-translational modificationsFunctional assays, complex formation studies

*Tag type is determined during manufacturing process

The E. coli system is most widely used due to its high yield and cost-effectiveness, particularly when using the full-length protein (1-171aa) fused to an N-terminal His tag . Expression conditions must be optimized to maintain protein solubility, including growth temperature, IPTG concentration, and induction time .

How can experimental design approaches improve the soluble expression of EAT1b_0871 in E. coli?

Implementing a factorial experimental design approach can systematically optimize EAT1b_0871 expression conditions. Based on similar recombinant protein expression studies, the following methodology is recommended:

  • Establish a 2^n factorial design with key variables:

    • Growth temperature (25°C vs. 37°C)

    • IPTG concentration (0.1 mM vs. 1.0 mM)

    • Post-induction time (4h vs. 16h)

    • Media composition (minimal vs. rich)

    • OD600 at induction (0.4-0.6 vs. 0.8-1.0)

    • Addition of solubility enhancers (with vs. without)

  • Based on research with similar proteins, optimal conditions typically include:

    • Growth until OD600 of 0.8

    • Induction with 0.1 mM IPTG

    • Expression at 25°C for 4 hours

    • Media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose

This approach has been demonstrated to increase soluble protein yield by up to 250 mg/L in similar recombinant protein expression systems .

What are the predicted structural features of EAT1b_0871 protein and how do they relate to potential function?

The EAT1b_0871 protein contains several noteworthy structural features that provide insights into its potential function:

  • Transmembrane regions: The sequence analysis suggests multiple hydrophobic segments (particularly in the N-terminal region "MGQILLILLLQLIYVPVLTLRTIMLVKGK") indicating potential membrane association.

  • Conserved domains: The UPF0316 family domains typically have functions related to:

    • Membrane transport

    • Signal transduction

    • Stress response mechanisms

  • Secondary structure prediction indicates:

    • N-terminal region: predominantly α-helical (residues 1-60)

    • Central region: mixed α-helices and β-sheets (residues 61-120)

    • C-terminal region: predominantly β-sheets (residues 121-171)

Homology modeling with related proteins suggests a potential role in membrane-associated processes, though the specific function remains to be experimentally determined .

What methodological approaches should be used to study EAT1b_0871 interaction with other proteins?

For investigating EAT1b_0871 protein interactions, a multi-method approach is recommended:

  • In silico prediction methods:

    • Molecular docking simulations with predicted interaction partners

    • Protein-protein interaction prediction algorithms using sequence conservation

  • In vitro experimental techniques:

    • Co-immunoprecipitation (Co-IP) with His-tagged EAT1b_0871 as bait

    • Pull-down assays using recombinant EAT1b_0871 protein

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Validation experiments:

    • Yeast two-hybrid (Y2H) confirmatory tests

    • Microscale thermophoresis (MST) for binding affinity in solution

    • Biolayer interferometry for real-time binding analysis

When conducting these experiments, it's crucial to use appropriate controls and consider the potential membrane-associated nature of EAT1b_0871, which may necessitate the inclusion of detergents or lipid environments for proper conformation and function .

How can recombinant EAT1b_0871 be utilized to investigate the antibiotic properties of Exiguobacterium species?

Recent studies have identified antibiotic properties in Exiguobacterium species, suggesting potential applications for EAT1b_0871 in antibiotic research:

  • Comparative genomics approach:

    • Analyze secondary metabolite gene clusters in Exiguobacterium sp. genomes

    • Determine if EAT1b_0871 is associated with biosynthetic gene clusters

    • Investigate correlation between EAT1b_0871 sequence variations and antibiotic production

  • Functional characterization methodology:

    • Generate EAT1b_0871 knockout strains using CRISPR-Cas9

    • Perform complementation studies with recombinant protein

    • Evaluate changes in antibiotic production through disc diffusion assays

  • Structural biology techniques:

    • Determine if EAT1b_0871 interacts with known antimicrobial compounds

    • Investigate potential role in resistance mechanisms or transport systems

Exiguobacterium sp. RIT 452 has demonstrated activity against both Gram-positive and Gram-negative bacteria, including MRSA. Determining EAT1b_0871's role in this activity could provide valuable insights for novel antibiotic development .

What factors should be considered when designing experiments to elucidate the function of EAT1b_0871 when genomic context provides limited information?

When investigating proteins of unknown function like EAT1b_0871 with limited genomic context information, a systematic multi-faceted approach is essential:

  • Phylogenetic profiling:

    • Analyze co-occurrence patterns across diverse genomes

    • Identify consistently co-located genes that may function in the same pathway

  • Environmental condition analysis:

    • Test protein expression under various stress conditions (pH, temperature, salt)

    • Compare expression levels across growth phases

    • Examine regulation in response to membrane-disrupting agents

  • Subcellular localization experiments:

    • Generate fluorescently-tagged versions to visualize localization

    • Perform fractionation studies to determine membrane association

    • Use immunogold electron microscopy for precise localization

  • Phenotypic characterization:

    • Generate knockout mutants and assess phenotypic changes

    • Perform complementation studies with wild-type and mutated versions

    • Utilize conditional expression systems to study dosage effects

  • Structural determination approaches:

    • X-ray crystallography or cryo-EM to determine 3D structure

    • NMR spectroscopy for dynamic structural information

    • Computational structure prediction validated by experimental data

This comprehensive approach maximizes the chances of functional elucidation when working with proteins like EAT1b_0871 that belong to families with limited functional annotation .

How can researchers address the challenges of studying membrane-associated properties of EAT1b_0871?

Investigating potential membrane-associated properties of EAT1b_0871 requires specialized techniques and considerations:

  • Optimized purification protocols:

    • Use mild detergents (DDM, LMNG, or digitonin) during extraction

    • Consider amphipol or nanodisc reconstitution for native-like environments

    • Evaluate detergent screening to identify optimal stability conditions

  • Membrane integration analysis:

    • Implement protease accessibility assays to determine topology

    • Use fluorescence quenching experiments to assess membrane penetration depth

    • Perform FRET studies to examine protein-lipid interactions

  • Functional reconstitution approaches:

    • Develop proteoliposome systems with defined lipid compositions

    • Assess functional properties in giant unilamellar vesicles (GUVs)

    • Utilize planar lipid bilayers for electrophysiological measurements if channel activity is suspected

  • Structural studies considerations:

    • Apply lipidic cubic phase crystallization for membrane protein structure

    • Utilize cryo-EM with optimized detergent or nanodisc preparations

    • Implement hydrogen-deuterium exchange mass spectrometry to identify membrane-interfacing regions

  • Computational modeling:

    • Perform molecular dynamics simulations in explicit membrane environments

    • Calculate free energy of insertion using specialized algorithms

    • Model potential conformational changes associated with membrane interaction

These methodological approaches address the specific challenges of membrane protein research while providing robust data on EAT1b_0871's potential membrane association and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.