Recombinant Exiguobacterium sp. UPF0365 protein EAT1b_0602 (EAT1b_0602)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; EAT1b_0602; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Target Names
EAT1b_0602
Target Protein Sequence
MTPELLTTLLITGGGLIALAVFFTFVPVGLWISSFAAGVHVSIFTLIGMRLRRVIPSKIV NPLIKAVKAGIELNTNQLESHFLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIDRLVGGAGEETIIARVGEGV VSTIGSQNNHKHVLENPDMISRTVLTKGLDSGTAFEILSIDIADIDIGKNIGAVLQTDQA EADKKIAQAKAEERRAMAIAREQEMKSSVEEMRAKVVGAEAEVPLAMAEALRNGKLGVMD YVNYLNVQADTEMRKAIGAPVDSESDNE
Uniprot No.

Target Background

Function
Found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs exhibit high dynamism and increase in number with cellular aging. Flotillins are believed to play a significant role in maintaining membrane fluidity.
Database Links
Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft; Multi-pass membrane protein.

Q&A

How is EAT1b_0602 classified in protein databases and what homologs exist?

EAT1b_0602 is classified under UniProt accession number C4L412 and belongs to the UPF0365 protein family. The "UPF" designation indicates that it is a protein of unknown function. Comparative sequence analysis reveals homologs in other Exiguobacterium species and related genera, though functional characterization across these homologs remains limited. The protein is categorized in the KEGG database (eat:EAT1b_0602) and can be found in the STRING database (360911.EAT1b_0602) for protein-protein interaction predictions .

What expression systems are most effective for producing functional EAT1b_0602 protein?

Multiple expression systems have been successfully employed for EAT1b_0602 production:

Expression SystemProduct CodeAdvantagesConsiderations
E. coliCSB-EP504701EPU1High yield, cost-effective, rapid productionPotential endotoxin contamination, may lack post-translational modifications
Mammalian cellsCSB-MP504701EPU1Natural folding, authentic post-translational modificationsLower yield, higher cost, longer production time
YeastCSB-YP504701EPU1Good folding, moderate yield, some post-translational capabilitiesMay have hyperglycosylation
BaculovirusCSB-BP504701EPU1High expression levels, eukaryotic processingMore complex system to establish

What purification strategies yield highest protein quality for EAT1b_0602?

A multi-step purification approach is recommended:

  • Initial capture: Affinity chromatography utilizing the tag incorporated during expression (His, GST, or other tags determined during production)

  • Intermediate purification: Ion exchange chromatography to separate charged variants

  • Polishing step: Size exclusion chromatography to achieve final purity and remove aggregates

The optimal buffer composition during purification includes:

  • Tris-based buffer (pH 7.5-8.0)

  • 150-300 mM NaCl

  • 50% glycerol for stability

  • Optional: reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation

For highest purity (>95%), combining affinity chromatography with at least one additional purification step is essential. The typical yield from E. coli expression systems ranges from 5-15 mg per liter of culture, with final purity exceeding 85% as confirmed by SDS-PAGE analysis .

What are the optimal storage conditions for maintaining EAT1b_0602 stability over time?

Long-term stability of EAT1b_0602 requires careful storage consideration:

Storage FormTemperatureShelf LifeNotes
Liquid-20°C/-80°C6 monthsIn Tris-based buffer with 50% glycerol
Lyophilized-20°C/-80°C12 monthsReconstitute before use
Working aliquots4°CUp to 1 weekFor immediate experimental use

Repeated freeze-thaw cycles significantly reduce protein stability and should be strictly avoided. For optimal preservation, store the protein in small single-use aliquots (50-100 μL) to minimize freeze-thaw events. Adding protease inhibitor cocktail (at manufacturer's recommended concentration) can further extend stability for sensitive applications .

What is the recommended protocol for reconstitution of lyophilized EAT1b_0602?

For optimal reconstitution of lyophilized EAT1b_0602:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (or 5-50% range depending on downstream applications)

  • Gently mix by inversion rather than vortexing to prevent protein denaturation

  • Allow complete rehydration for 30 minutes at room temperature

  • Aliquot and store at -20°C/-80°C for long-term storage

The reconstituted protein should be used immediately or properly stored to maintain integrity. Verification of protein quality post-reconstitution by SDS-PAGE analysis is recommended for critical applications .

How can EAT1b_0602 be effectively used in protein-protein interaction studies?

When investigating protein-protein interactions involving EAT1b_0602, consider these methodological approaches:

  • Pull-down assays: Utilize tagged EAT1b_0602 (His, GST, or biotin-tagged variants like CSB-EP504701EPU1-B) as bait protein immobilized on appropriate resin. Incubate with cellular lysates or purified candidate proteins, then analyze bound proteins by western blotting or mass spectrometry.

  • Surface Plasmon Resonance (SPR): Immobilize EAT1b_0602 on sensor chips to measure real-time binding kinetics with potential interaction partners. Critical parameters include:

    • Protein concentration: 10-100 μg/mL for immobilization

    • Buffer: HBS-EP (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% surfactant P20)

    • Flow rate: 5-30 μL/min depending on expected kinetics

  • Yeast two-hybrid screening: Use EAT1b_0602 as bait to screen for interacting partners from genomic or cDNA libraries.

When reporting interaction results, quantitative measurements (KD values from SPR, enrichment ratios from pull-downs) provide more reliable data than qualitative observations alone .

What are the considerations for using EAT1b_0602 in structural studies?

For structural characterization of EAT1b_0602:

  • Sample preparation for crystallography:

    • Purify to >95% homogeneity using multi-step chromatography

    • Remove the affinity tag if possible as it may interfere with crystal formation

    • Concentrate to 5-15 mg/mL in a buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Perform pre-crystallization tests to optimize protein concentration and buffer conditions

  • NMR spectroscopy considerations:

    • Express protein in minimal media with 15N-ammonium chloride and/or 13C-glucose for isotopic labeling

    • Final buffer should contain minimal salt (50-100 mM) and no glycerol

    • Typical concentration range: 0.3-1.0 mM protein

    • Maintain sample at 4-10°C during data collection to prevent degradation

  • Cryo-EM sample preparation:

    • Protein concentration: 0.5-5 mg/mL

    • Apply to glow-discharged grids

    • Optional: crosslink with glutaraldehyde (0.1%) for stabilization

Potential challenges include protein flexibility and aggregation tendency, which may require screening various constructs with N- or C-terminal truncations to identify stable, crystallizable fragments .

How can site-directed mutagenesis of EAT1b_0602 provide insights into its structure-function relationship?

Strategic mutagenesis approaches for EAT1b_0602 functional characterization include:

  • Transmembrane domain analysis: The hydrophobic segments in EAT1b_0602 (amino acids 9-31 and 40-62) suggest transmembrane domains. Substitute these regions with alanine residues to assess membrane localization and protein function.

  • Conserved motif targeting: Analysis reveals several conserved motifs across UPF0365 family proteins:

    • GVHVSIFT motif (residues 55-62): Likely involved in protein-protein interactions

    • LRRVIPSKIV motif (residues 72-81): Potential regulatory site

    • IGAVLQTDQA motif (residues 271-280): Conserved across Exiguobacterium species

  • Phosphorylation site prediction and validation: Computational analysis predicts potential phosphorylation sites at S63, T215, and S324. Create phosphomimetic (S→D or T→E) and phosphodeficient (S→A or T→A) mutants to assess functional implications.

Recommended experimental workflow:

  • Generate mutations using PCR-based site-directed mutagenesis

  • Express both wild-type and mutant proteins in parallel

  • Compare stability, solubility, and oligomeric state using analytical SEC

  • Assess membrane association using cellular fractionation

  • Evaluate functional activity in relevant assays

Document changes in physicochemical properties, cellular localization, and functional activities between wild-type and mutant proteins to build a comprehensive structure-function map .

What approaches can be used to identify the physiological role of EAT1b_0602 in Exiguobacterium sp.?

To elucidate the physiological function of EAT1b_0602, a multi-faceted approach is recommended:

  • Genomic context analysis:

    • Examine neighboring genes in the Exiguobacterium sp. genome

    • Identify conserved operonic structures across related species

    • Map potential regulatory elements upstream of the gene

  • Gene disruption strategies:

    • CRISPR-Cas9 mediated knockout (if established for Exiguobacterium)

    • Homologous recombination-based gene replacement

    • Antisense RNA expression to downregulate expression

  • Phenotypic characterization of mutants under various conditions:

    • Growth rate analysis under different temperatures (4°C, 25°C, 37°C)

    • Stress resistance (pH, osmotic, oxidative stress)

    • Membrane integrity assessment

    • Metabolic profiling using LC-MS or GC-MS

  • Complementation studies:

    • Reintroduce wild-type gene to confirm phenotype reversal

    • Test if homologs from related species can functionally complement

  • Transcriptomic and proteomic profiling:

    • RNA-seq comparing wild-type and mutant strains

    • Quantitative proteomics to identify altered protein networks

This integrated approach should be conducted under multiple growth conditions relevant to Exiguobacterium's natural habitat to capture condition-specific functions .

What quality control measures should be implemented when working with recombinant EAT1b_0602?

A comprehensive quality control workflow for EAT1b_0602 includes:

QC ParameterMethodAcceptance Criteria
PuritySDS-PAGE>85% single band
IdentityWestern blotPositive reaction with anti-tag antibody
Mass spectrometryMass within 0.5% of theoretical value
Secondary structureCircular dichroismConsistent α-helical content between batches
HomogeneitySize exclusion chromatographySingle, symmetrical peak
Endotoxin contentLAL assay<1 EU/mg protein (for E. coli-derived protein)
FunctionalityApplication-specific assayDependent on experimental requirements

For lot-to-lot consistency, maintain a reference standard from a well-characterized batch and compare each new preparation against this standard. Document all QC results in a batch record for traceability and reproducibility of research findings .

What are common issues encountered when working with EAT1b_0602 and their solutions?

Common challenges and troubleshooting strategies when working with EAT1b_0602:

  • Low expression yield:

    • Solution: Optimize codon usage for expression host

    • Check for toxicity and use tightly regulated promoters

    • Lower induction temperature (16-20°C)

    • Consider using fusion partners (MBP, SUMO) to enhance solubility

  • Protein aggregation:

    • Solution: Include mild detergents (0.1% NP-40 or 0.05% DDM)

    • Optimize buffer conditions (pH 7.5-8.0, 150-300 mM NaCl)

    • Add stabilizing agents (5-10% glycerol, 1 mM EDTA)

    • Perform purification at 4°C

  • Proteolytic degradation:

    • Solution: Add protease inhibitor cocktail during purification

    • Reduce processing time

    • Identify and remove vulnerable linker regions

  • Loss of activity during storage:

    • Solution: Store in small aliquots with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Consider protein-specific stabilizing additives

  • Tag interference with function:

    • Solution: Compare N- and C-terminally tagged versions

    • Remove tag with specific proteases (TEV, PreScission)

    • Use smaller tags (His6 instead of larger tags)

Document all optimization steps systematically to establish reproducible protocols for subsequent studies .

How can EAT1b_0602 be leveraged in heterologous expression systems for functional studies?

When employing EAT1b_0602 in heterologous expression systems:

  • Expression in model bacteria (E. coli, B. subtilis):

    • Evaluate membrane localization using fluorescent protein fusions

    • Assess impact on host membrane integrity and composition

    • Monitor changes in stress response pathways using transcriptomics

  • Yeast expression systems:

    • Use complementation approaches in yeast strains with deletions of potential functional homologs

    • Monitor cellular phenotypes including growth, membrane organization, and stress response

    • Employ split-ubiquitin membrane yeast two-hybrid for identifying interaction partners

  • Mammalian cell expression:

    • Evaluate effects on membrane organization using confocal microscopy

    • Assess impacts on cellular signaling using phosphoproteomics

    • Identify mammalian interaction partners using proximity labeling approaches (BioID, APEX)

Key experimental considerations:

  • Include proper negative controls (empty vector, inactive mutant)

  • Validate expression using both transcript (RT-qPCR) and protein (western blot) analysis

  • Normalize expression levels when comparing different constructs

  • Consider inducible expression systems to control expression timing and levels

This approach can reveal conserved functions across diverse cellular contexts and may uncover novel roles not evident in the native organism .

What computational approaches can predict functional domains and interacting partners of EAT1b_0602?

Integrated computational analysis workflow for EAT1b_0602:

  • Structural prediction and domain analysis:

    • AlphaFold2 for 3D structure prediction

    • InterProScan for domain annotation

    • TMHMM/TOPCONS for transmembrane topology prediction

    • ConSurf for evolutionary conservation mapping

  • Molecular dynamics simulations:

    • Embed predicted structure in membrane models

    • Simulate behavior in explicit lipid bilayers

    • Identify stable conformations and potential binding pockets

  • Protein-protein interaction prediction:

    • STRING database analysis of genomic context and co-occurrence

    • PIPE (Protein-Protein Interaction Prediction Engine) for sequence-based interaction prediction

    • Molecular docking with candidate interacting proteins

    • Coevolution analysis using methods like DCA (Direct Coupling Analysis)

  • Function prediction:

    • Gene Ontology term prediction using tools like DeepGOPlus

    • Comparison with structurally similar proteins using Dali server

    • Ligand binding site prediction using FTSite

  • Systems-level analysis:

    • Genomic neighborhood analysis across bacterial species

    • Co-expression network construction

    • Pathway enrichment analysis

The integration of these computational approaches provides testable hypotheses about EAT1b_0602 function that can guide experimental design. Results should be validated experimentally through targeted assays based on the computational predictions .

How does EAT1b_0602 compare structurally and functionally with other UPF0365 family proteins?

Comparative analysis of EAT1b_0602 with other UPF0365 family proteins reveals important insights:

OrganismProtein IdentifierSequence IdentityKey Structural FeaturesPredicted Function
Exiguobacterium sp. AT1bEAT1b_0602 (C4L412)100% (reference)2 transmembrane domains, conserved cytoplasmic domainMembrane organization, potential stress response
Exiguobacterium sibiricumExig_057478%Similar TM topology, conserved C-terminal domainLikely functionally equivalent
Bacillus subtilisYwlG42%Divergent N-terminal region, conserved central domainSimilar but potentially specialized function
Listeria monocytogeneslmo130238%Additional C-terminal extensionPossibly involved in cell wall interactions

Key observations:

  • The transmembrane domains show highest conservation, suggesting critical membrane-anchoring function

  • The C-terminal domain (residues 240-328) shows moderate conservation, potentially indicating a conserved interaction site

  • The central domain shows variable conservation, possibly reflecting species-specific adaptations

These comparative analyses suggest that while EAT1b_0602 likely shares core functions with other UPF0365 family members, the variability in certain regions may confer species-specific functionalities relevant to Exiguobacterium's particular environmental adaptations .

What insights can cross-species expression studies of EAT1b_0602 provide?

Cross-species expression studies of EAT1b_0602 offer valuable insights into protein function:

  • Heterologous expression in diverse bacterial hosts:

    • Express in phylogenetically distinct hosts (E. coli, B. subtilis, Pseudomonas)

    • Assess complementation of UPF0365 knockouts across species

    • Evaluate impact on host physiology and membrane properties

    Methodology: Use consistent expression vectors with compatible origins of replication and similar promoter strength. Normalize for expression levels using qPCR and western blotting.

  • Domain-swapping chimeras:

    • Create fusion proteins swapping domains between EAT1b_0602 and homologs

    • Test functionality in appropriate knockout backgrounds

    • Identify domains responsible for species-specific functions

    Experimental design: Create chimeras at conserved junctions to minimize structural disruption. Express multiple constructs with swapped N-terminal, central, and C-terminal domains.

  • Species-specific interaction network mapping:

    • Perform pull-down experiments in native and heterologous hosts

    • Compare interaction partners using mass spectrometry

    • Validate key interactions using targeted approaches (co-IP, FRET)

    Data analysis: Use differential interaction mapping to identify conserved vs. host-specific protein partners.

  • Environmental stress response evaluation:

    • Test complementation under various stress conditions (temperature, pH, osmotic)

    • Compare relative fitness contributions across different host species

    Key metrics: Growth rates, survival percentages, membrane integrity measurements.

This multi-faceted approach can differentiate between conserved core functions and species-specialized adaptations, providing evolutionary context for the role of UPF0365 family proteins .

What emerging technologies could advance our understanding of EAT1b_0602?

Cutting-edge technologies that could significantly advance EAT1b_0602 research:

  • Cryo-electron tomography:

    • Visualize EAT1b_0602 in its native membrane environment

    • Determine spatial organization and potential interaction complexes

    • Observe structural changes under different physiological conditions

  • In-cell NMR spectroscopy:

    • Monitor protein dynamics in living cells

    • Detect structural changes upon interaction with partners

    • Identify ligand binding in physiological context

  • Genome-wide CRISPR screens in heterologous hosts:

    • Identify genetic interactions with EAT1b_0602

    • Discover conditional phenotypes and potential functional pathways

    • Map synthetic lethal interactions

  • Protein painting combined with mass spectrometry:

    • Map solvent-accessible surfaces in membrane environment

    • Identify regions involved in protein-protein interactions

    • Detect conformational changes upon activation

  • Single-molecule tracking in live cells:

    • Visualize protein diffusion and localization patterns

    • Detect clustering behavior and interaction dynamics

    • Measure residence times at specific cellular locations

  • Deep mutational scanning:

    • Systematically assess impact of all possible amino acid substitutions

    • Identify critical residues for function and stability

    • Create comprehensive fitness landscape

These advanced approaches could resolve current knowledge gaps regarding EAT1b_0602's structural dynamics, interaction partners, and precise molecular function within the cell .

How might understanding EAT1b_0602 contribute to broader knowledge in bacterial membrane biology?

The study of EAT1b_0602 has potential to contribute significantly to several fundamental areas in bacterial membrane biology:

  • Extremophile membrane adaptation mechanisms:

    • Exiguobacterium species thrive in diverse environments including cold, alkaline, and high-salt conditions

    • EAT1b_0602 may represent a novel membrane adaptation mechanism

    • Comparative studies across Exiguobacterium strains from different extreme environments could reveal environment-specific adaptations

  • Novel membrane protein families and functions:

    • UPF0365 represents a poorly characterized protein family

    • Functional characterization could reveal previously unknown membrane protein functions

    • May establish new paradigms in membrane organization or stress response

  • Bacterial membrane microdomains:

    • Increasing evidence suggests bacteria organize membrane proteins into functional domains

    • EAT1b_0602 may participate in or regulate such domain formation

    • Could provide insights into bacterial membrane compartmentalization principles

  • Membrane-associated stress response mechanisms:

    • Environmental stress often impacts membrane integrity

    • EAT1b_0602 may function in sensing or responding to membrane stress

    • Understanding this role could reveal novel bacterial stress adaptation strategies

  • Evolution of membrane protein functions:

    • Comparative analysis across bacterial phyla can illuminate evolutionary trajectories

    • May reveal how membrane proteins adapt to specific ecological niches

    • Could identify conserved functional principles across diverse bacteria

These broader contributions extend beyond the specific function of EAT1b_0602 itself, potentially informing fundamental concepts in bacterial physiology, adaptation mechanisms, and principles of membrane protein evolution .

What are the best approaches for studying EAT1b_0602 membrane integration and topology?

To accurately determine EAT1b_0602 membrane integration and topology:

  • Biochemical approaches:

    • Protease accessibility assays: Express in bacterial systems with epitope tags at various positions. Treat intact cells/spheroplasts with proteases and analyze protected fragments.

    • Chemical labeling: Use membrane-impermeable thiol-reactive reagents (e.g., maleimide-PEG) to label engineered cysteine residues, revealing their cytoplasmic or periplasmic location.

    • Reporter fusion analysis: Create systematic fusions with dual reporters (e.g., GFP/PhoA) at different positions. PhoA activity indicates periplasmic localization while GFP fluorescence suggests cytoplasmic orientation.

  • Biophysical methods:

    • Site-directed spin labeling with EPR: Introduce spin labels at strategic positions and measure accessibility parameters to determine membrane-embedded regions.

    • FRET-based distance measurements: Incorporate donor-acceptor pairs at predicted loop regions to confirm structural model.

    • Hydrogen-deuterium exchange mass spectrometry: Identify regions protected from exchange, indicating membrane-embedded domains.

  • Structural approaches:

    • Cryo-EM of membrane-reconstituted protein: Visualize directly in lipid nanodiscs or liposomes.

    • Solid-state NMR: Determine orientation and dynamics of transmembrane helices.

  • Computational validation:

    • Cross-validate experimental findings with multiple prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Molecular dynamics simulations in explicit membrane models

Recommended experimental workflow integrates multiple approaches for highest confidence in topology mapping. Begin with computational predictions, then confirm experimentally using at least two independent methods .

What controls should be included when conducting functional assays with EAT1b_0602?

Robust experimental design for EAT1b_0602 functional assays requires comprehensive controls:

  • Protein quality controls:

    • Positive control: Well-characterized protein from same family or with similar properties

    • Negative control: Heat-denatured EAT1b_0602 (95°C, 10 minutes)

    • Tag-only control: Expression/purification of tag alone without EAT1b_0602

    • Mutant controls: Non-functional mutants (based on conservation analysis)

  • Expression system controls:

    • Empty vector control: Host cells containing expression vector without insert

    • Housekeeping control: Expression of non-related membrane protein using same system

    • Induction control: Non-induced samples containing EAT1b_0602 construct

  • Assay-specific controls:

    • For membrane localization: Known membrane and cytosolic markers

    • For stress response assays: Known stress-sensitive and resistant strains

    • For interaction studies: Known interacting pairs and non-interacting proteins

    • For complementation experiments: Wild-type strain and clean knockout

  • Technical validation controls:

    • Biological replicates: Minimum three independent experiments

    • Technical replicates: Minimum three measurements per experiment

    • Concentration gradient: Test multiple protein concentrations to establish dose-response

    • Time course measurements: Capture temporal dynamics of interactions/responses

  • Statistical analysis requirements:

    • Appropriate statistical tests based on data distribution

    • Multiple testing correction for high-throughput experiments

    • Power analysis to ensure sufficient sample size

Implementation of these controls ensures experimental rigor and facilitates distinction between specific effects and experimental artifacts. Document all control results alongside experimental data for comprehensive reporting .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.