Recombinant Exiguobacterium sp. UPF0756 membrane protein EAT1b_0668 (EAT1b_0668)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using an in vitro E. coli expression system, yielding soluble forms in Tris/PBS-based buffers with 50% glycerol or 6% trehalose for stability .

ParameterDetails
Expression SystemE. coli (optimized for high yield)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder or liquid; reconstitution in sterile water recommended.
Buffer CompositionpH 8.0, with glycerol or trehalose to prevent aggregation .

Genomic Context and Functional Insights

The EAT1b_0668 gene is located on the chromosome of Exiguobacterium sp. AT1b (GenBank: CP001615), a thermophile isolated from Yellowstone National Park hot springs . Key genomic features:

Genomic AttributeValue
Chromosome Size2,999,895 bp
GC Content48.5% (genome-wide); 56.1% in rRNA operons
Gene PositionComplement of 620,730–621,194 bp (NC_012673.1)
Phylogenetic ContextClustered within Bacillales family XII

Although functional pathways remain uncharacterized, the presence of hydrophobic domains suggests roles in membrane integrity or solute transport . No homologs with experimentally validated functions are documented .

Applications and Research Utility

EAT1b_0668 is primarily used in:

  • Structural Studies: Investigating membrane protein folding in thermophiles .

  • Antibody Development: Serving as an immunogen for antibody production against Exiguobacterium membrane proteins .

  • Biochemical Assays: Testing stability under extreme conditions (e.g., high temperature, alkaline pH) .

Limitations and Future Directions

Current knowledge gaps include its physiological role and interaction partners. Comparative studies with psychrophilic Exiguobacterium species (e.g., E. sibiricum) could elucidate thermal adaptation mechanisms . Industrial applications, such as biocatalysis in extreme environments, remain unexplored but plausible given the genus’s resilience .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
EAT1b_0668; UPF0756 membrane protein EAT1b_0668
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Target Names
EAT1b_0668
Target Protein Sequence
MSAYLFLLMLVLIGVISNNQSVIIASSVLLIIKAIGFGDQLFPTLASKGISWGVTIITIA VLVPIATGDIGFKELWNSIKGPVGIVAFASGMFVAIAAGQGVQLMRVDPVVTTALLAGTI LAVGFMKGIPVGPLVGAGIAALILGGYQVIEKWF
Uniprot No.

Target Background

Database Links
Protein Families
UPF0756 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is EAT1b_0668 and what organism does it originate from?

EAT1b_0668 is a membrane protein belonging to the UPF0756 family found in Exiguobacterium sp. AT1b (strain ATCC BAA-1283), a thermophilic bacterium isolated from Angel Terrace at Mammoth Terrace in Yellowstone National Park . This non-spore forming, Gram-positive, catalase-positive bacterium grows optimally at elevated temperatures (15-50°C) and forms orange colonies on TSA media . Exiguobacterium sp. AT1b was isolated in 2004 from a slightly alkaline, highly carbonate hot spring water sample . The genome of this organism has been fully sequenced (GenBank accession number CP001615) to serve as a comparative resource for studying thermal adaptation mechanisms .

How do researchers typically express and purify recombinant EAT1b_0668?

The expression and purification of EAT1b_0668 typically follows these methodological steps:

  • Host selection: E. coli is commonly used as the expression host

  • Vector construction: The gene is cloned into an expression vector with an N-terminal or C-terminal His-tag for purification

  • Expression conditions: Optimization of temperature, induction parameters, and media composition is crucial for membrane protein expression

  • Membrane extraction: Cells are lysed and membranes isolated via ultracentrifugation

  • Solubilization: Membrane proteins are extracted using appropriate detergents

  • Purification: Affinity chromatography using the His-tag followed by size exclusion chromatography

Commercial sources offer recombinant EAT1b_0668 with His-tags, as indicated in this product table:

Cat.#Product nameSource (Host)SpeciesTagProtein Length
RFL14720EFRecombinant Full Length Exiguobacterium Sp. Upf0756 Membrane Protein Eat1B_0668 (Eat1B_0668) ProteinE.coliExiguobacterium sp.HisFull L. Full Length (1-154)

What techniques are most effective for studying the membrane topology of EAT1b_0668?

To elucidate the membrane topology of EAT1b_0668, researchers should employ multiple complementary techniques:

  • Membrane protein-enriched extracellular vesicles (MPEEVs): This platform allows studying intact membrane proteins natively anchored with correct topology . The process involves:

    • Transfection of cells with EAT1b_0668 expression plasmids

    • Collection of vesicles secreted into the medium

    • Purification via ultracentrifugation

    • Visualization using cryo-EM and cryo-ET to characterize protein incorporation in membranes

  • Subvolume averaging of cryo-ET data: This approach significantly improves signal-to-noise ratio through:

    • Automatic picking of several hundred subvolumes at vesicle surfaces

    • Iterative alignment and averaging in an unbiased, reference-free manner

    • Generation of 3D reconstructions of membrane-embedded proteins

  • Cysteine scanning mutagenesis: This approach involves:

    • Introducing cysteine residues at various positions within the protein sequence

    • Labeling with membrane-impermeable or permeable sulfhydryl reagents

    • Determining the accessibility of each position to define internal vs. external domains

How might the structure and function of EAT1b_0668 contribute to thermal adaptation in Exiguobacterium sp. AT1b?

The role of EAT1b_0668 in thermal adaptation can be investigated through comparative genomic and experimental approaches:

  • Comparative analysis: Exiguobacterium sp. AT1b (thermophilic) and E. sibiricum 255-15 (psychroactive) provide an excellent model system for studying thermal adaptation mechanisms . The membrane proteins, including EAT1b_0668, likely play critical roles in maintaining membrane integrity at different temperatures.

  • Membrane composition adaptation: Exiguobacterium species employ two primary strategies for temperature adaptation:

    • Fatty acid desaturases (FADs) modify membrane lipid composition to maintain appropriate fluidity

    • EAT1b_0668 may work in concert with these systems to maintain membrane structural integrity at elevated temperatures

  • Ion transport and pH homeostasis: Many membrane proteins in Exiguobacterium contribute to multiple compound resistance and pH homeostasis:

    • Various Na⁺:H⁺ antiporters, including CPA1, CPA2, CPA3, and NhaC family members, are present in Exiguobacterium genomes

    • EAT1b_0668 may contribute to ion balance maintenance at elevated temperatures

What advanced structural biology approaches can be applied to determine the three-dimensional structure of EAT1b_0668?

Determining the structure of membrane proteins like EAT1b_0668 requires specialized approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Sample preparation using membrane protein-enriched extracellular vesicles (MPEEVs)

    • Data collection under cryogenic conditions to preserve native structure

    • Image processing and 3D reconstruction using specialized software

  • Electron cryotomography (cryo-ET) with subvolume averaging:

    • This technique has successfully visualized membrane proteins in vesicles, revealing:

      • Protein orientation in the membrane

      • Structural domains protruding from the membrane surface

      • Oligomeric state of the protein

  • X-ray crystallography with lipidic cubic phase (LCP):

    • Purification in appropriate detergents

    • Reconstitution in lipidic cubic phase

    • Crystal growth and diffraction data collection

    • Structure determination and refinement

The choice of approach depends on protein stability, expression levels, and research questions. For EAT1b_0668, the MPEEVs approach may be particularly suitable as demonstrated for other membrane proteins: "To characterize the protein incorporation in the membrane, the vesicles were imaged with electron cryomicroscopy (cryo-EM) and electron cryotomography (cryo-ET)... For the EFF-1 and gB structures, several hundred subvolumes were automatically picked at the vesicle surfaces using a local minimum search. These volumes were then iteratively aligned and averaged in an unbiased, reference-free manner."

What approaches can identify potential interaction partners of EAT1b_0668 in Exiguobacterium sp. AT1b?

To identify interaction partners of EAT1b_0668, researchers should apply multiple complementary approaches:

  • Crosslinking mass spectrometry:

    • Treat intact cells or membrane preparations with crosslinking reagents

    • Isolate EAT1b_0668 and its crosslinked partners

    • Perform in-solution trypsin digestion as described in the literature

    • Analyze using nano ultraperformance liquid chromatography tandem mass spectrometry (UPLC-MS/MS)

    • Quantify relative protein abundance using the empirically modified abundance index (emPAI)

  • Protein co-purification:

    • Express tagged EAT1b_0668 in native Exiguobacterium sp. AT1b

    • Isolate membrane fractions and solubilize

    • Perform pull-down experiments with appropriate controls

    • Identify co-purifying proteins by mass spectrometry

  • Bacterial two-hybrid systems:

    • Construct genomic library of Exiguobacterium sp. AT1b

    • Screen for interactions with EAT1b_0668 using membrane-specific two-hybrid systems

    • Validate interactions through orthogonal methods

How does EAT1b_0668 compare between thermophilic and psychroactive Exiguobacterium species, and what does this reveal about thermal adaptation mechanisms?

A comparative analysis of EAT1b_0668 homologs between thermophilic and psychroactive Exiguobacterium species provides insights into thermal adaptation:

  • Genomic comparison:

    • Exiguobacterium sp. AT1b and E. sibiricum 255-15 represent thermophilic and psychroactive extremes (growth ranges: 15-50°C vs. -6-40°C)

    • Comparative analysis of their genomes reveals adaptations to different temperature niches

  • Sequence and structural adaptation mechanisms:

    • Amino acid composition differences that affect protein flexibility and stability

    • Variations in membrane-spanning domains that influence membrane fluidity maintenance

    • Post-translational modifications that may differ between temperature extremes

  • Functional experiments:

    • Heterologous expression of EAT1b_0668 variants in model organisms

    • Analysis of growth and membrane integrity at different temperatures

    • Chimeric protein construction to identify thermally critical domains

This comparative approach aligns with research objectives stated in the literature: "Having the strains and genome sequences of thermophilic Exiguobacterium sp. AT1b and its psychroactive relative, Exiguobacterium sibiricum 255-15, which was isolated from Siberian permafrost and has a growth range from −6° to 40°C, enables investigation of the genetic basis of microbial adaptation to different temperatures and is of interest in the fields of agriculture, industrial microbiology, and astrobiology."

What are the main challenges in expressing and purifying membrane proteins like EAT1b_0668, and how can researchers overcome them?

Membrane protein expression and purification faces several challenges:

  • Toxicity and inclusion body formation:

    • Solution: Use tunable expression systems with low basal expression

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider specialized expression hosts designed for membrane proteins

  • Proper membrane insertion:

    • Solution: Co-express with chaperones that assist membrane insertion

    • Use expression vectors with signal sequences optimized for membrane targeting

    • Consider cell-free expression systems with supplied lipid environments

  • Protein extraction and stability:

    • Solution: Screen multiple detergents for optimal solubilization

    • Incorporate stabilizing ligands during purification

    • Consider alternative solubilization approaches like styrene maleic acid lipid particles (SMALPs)

  • Functional verification:

    • Solution: Develop activity assays specific to predicted function

    • Use biophysical techniques to assess proper folding

    • Consider reconstitution into proteoliposomes or nanodiscs to verify function

How can CRISPR-Cas9 genome editing be applied to study the physiological role of EAT1b_0668 in Exiguobacterium sp. AT1b?

CRISPR-Cas9 genome editing can be adapted for use in Exiguobacterium sp. AT1b with the following methodological approach:

  • Development of transformation protocols:

    • Optimize electroporation conditions for Exiguobacterium sp. AT1b

    • Develop selection markers suitable for this thermophilic organism

    • Create shuttle vectors that function in both E. coli and Exiguobacterium

  • CRISPR-Cas9 system adaptation:

    • Select Cas9 variants with activity at elevated temperatures

    • Design guide RNAs targeting EAT1b_0668 with high specificity

    • Include homology-directed repair templates for gene deletion or modification

  • Phenotypic analysis of mutants:

    • Compare growth rates at different temperatures (15-50°C)

    • Analyze membrane integrity and permeability

    • Assess resistance to environmental stresses (pH, salinity)

  • Complementation studies:

    • Reintroduce wild-type or modified EAT1b_0668 to confirm phenotype specificity

    • Perform cross-species complementation with homologs from psychroactive Exiguobacterium

What strategies can be employed to study the potential role of EAT1b_0668 in virulence if Exiguobacterium sp. is being investigated for pathogenic potential?

Recent evidence suggests potential pathogenicity of Exiguobacterium species, warranting investigation of membrane proteins like EAT1b_0668 in this context:

  • Comparative genomic analysis:

    • Compare EAT1b_0668 with homologs in clinical isolates like Exiguobacterium sp. A1b/GX59

    • Identify possible connections to virulence factors: "In its genome, a series of unique virulence genes were identified, including tlyC encoding hemolysin, a type of membrane-damaging toxin, NprR encoding a quorum-sensing receptor, mcp (methyl accepting chemotaxis proteins) and Dam (DNA adenine methylase)"

  • Infection model experiments:

    • Develop appropriate cell culture or animal models for Exiguobacterium infection

    • Compare wild-type and EAT1b_0668 knockout strains for virulence differences

    • Study host-pathogen interactions through microscopy and transcriptomics

  • Membrane proteome analysis:

    • Compare membrane protein composition between environmental and clinical isolates

    • Identify proteins co-expressed with EAT1b_0668 under infection-mimicking conditions

    • Evaluate potential interactions with host factors

  • Secretome analysis:

    • Investigate whether EAT1b_0668 affects secretion of virulence factors

    • Analyze extracellular vesicle composition and potential virulence associations

How might studying EAT1b_0668 contribute to biotechnological applications of thermophilic bacteria?

Research on EAT1b_0668 has several potential biotechnological applications:

  • Enzyme thermostabilization:

    • Understanding how membrane proteins maintain stability at high temperatures can inform enzyme engineering

    • Principles derived from EAT1b_0668 structure may be transferable to industrial enzymes

    • Thermostable membrane-associated enzyme systems could be developed for biocatalysis

  • Bioprocess engineering:

    • Insights into membrane adaptations can improve high-temperature bioprocesses

    • Enhanced fermentation at elevated temperatures can reduce cooling costs and contamination risks

    • The natural capabilities of Exiguobacterium for polysaccharide utilization could be exploited: "All of the strains effectively hydrolyzed starch, and approximately 70% could degrade proteins. Together, the results from our genomic analysis and activity testing provide strong evidence that most members of the Exiguobacterium genus can metabolize and utilize a wide range of polysaccharides and proteins from marine and nonmarine environments."

  • Biosensor development:

    • Thermostable membrane proteins could serve as components in robust biosensors

    • Applications in extreme environments where conventional sensors fail

    • Integration into microfluidic devices for high-temperature analyses

What bioinformatic approaches can predict the functional role of UPF0756 family proteins like EAT1b_0668?

Advanced bioinformatic strategies for functional prediction include:

  • Structure prediction and analysis:

    • Apply AlphaFold2 or RoseTTAFold to generate structural models

    • Identify potential binding pockets or functional domains

    • Compare with structures of proteins with known functions

  • Genomic context analysis:

    • Examine operonic organization around EAT1b_0668

    • Identify conserved gene neighborhoods across bacterial species

    • Analyze co-evolution patterns with functionally characterized proteins

  • Comparative genomics across Exiguobacterium species:

    • Correlate presence/absence of EAT1b_0668 homologs with phenotypic traits

    • Identify signatures of selection that might indicate functional importance

    • Compare with related proteins in the extensive genomic datasets available for Exiguobacterium: "The issue of adaptations to different temperatures is of interest in the field of astrobiology. Organisms that inhabit such diametrally opposite environments may be used as models for understanding cellular responses on astral bodies."

  • Network-based approaches:

    • Construct protein-protein interaction networks based on co-expression data

    • Apply machine learning to predict functional associations

    • Identify functional modules that include EAT1b_0668 homologs

How can synthetic biology approaches be used to engineer EAT1b_0668 for novel functions or improved stability?

Synthetic biology offers several strategies for engineering EAT1b_0668:

  • Directed evolution:

    • Develop high-throughput screens for desired properties

    • Apply error-prone PCR or DNA shuffling to generate variant libraries

    • Select variants with enhanced stability or novel functions

  • Rational design:

    • Identify critical residues through comparative analysis with homologs from different thermal environments

    • Apply computational design to engineer improved stability or function

    • Create chimeric proteins combining domains from thermophilic and psychroactive homologs

  • Non-canonical amino acid incorporation:

    • Introduce novel chemical functionalities through genetic code expansion

    • Enhance stability through specialized crosslinking amino acids

    • Create photoactivatable variants for temporal control of function

  • Minimal membrane protein design:

    • Identify the essential structural elements of EAT1b_0668

    • Design simplified versions retaining core functionality

    • Create modular systems for combining with other functional domains

This synthetic biology approach aligns with broader research on Exiguobacterium's adaptability: "The capacities shared by Exiguobacterium members, such as their diverse means of polysaccharide utilization and environmental-stress resistance, provide an important basis for their cosmopolitan distribution."

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.