Recombinant Fagopyrum esculentum subsp. ancestrale ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)
Target Names
atpI
Target Protein Sequence
MNLLSCSINTLRGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLSSAAIAVRN PQTIPTDGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFSKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does chloroplast ATP synthase function differ between wild and cultivated buckwheat species?

While the fundamental function of ATP synthase remains consistent across buckwheat species, certain structural and regulatory differences exist between wild and cultivated varieties. The chloroplast genomes of both Fagopyrum esculentum subsp. ancestrale (wild buckwheat) and Fagopyrum tataricum (tartary buckwheat) contain similar gene content and organization, but with some structural variations .

Both species maintain the ATP synthase complex as a critical energy-coupling enzyme, but research indicates that differences in the chloroplast genome may influence ATP synthase regulation. Sequence analysis has revealed that certain genes in the LSC (Large Single Copy) region, including those encoding ATP synthase components, show variation in selection pressure between wild and cultivated species. Specifically, several genes demonstrate elevated Ka/Ks ratios (>1.0), indicating positive selection and potentially reflecting adaptation to different environmental conditions .

Importantly, sequence similarity studies indicate that the Inverted Repeat (IR) regions of the chloroplast genome are more conserved than single copy regions, suggesting that ATP synthase genes located in these regions may retain higher functional consistency across species .

What is the role of redox regulation in chloroplast ATP synthase activity?

Chloroplast ATP synthase activity is regulated through multiple mechanisms, with redox regulation serving as a critical control point. Research demonstrates that redox modulation occurs via thioredoxin, which affects a disulfide/sulfhydryl pair on the γ subunit of the enzyme .

This regulation system involves:

  • A chloroplast-specific 9-amino acid "loop" in the γ subunit containing redox-active cysteine residues (Cys¹⁹⁹ and Cys²⁰⁵ in Arabidopsis thaliana)

  • Thioredoxin-mediated reduction of these cysteine residues in response to light conditions

  • Modulation of the proton motive force (pmf) threshold required to activate the ATP synthase

The redox regulation mechanism prevents wasteful ATP hydrolysis in the dark by increasing the pmf threshold required for enzyme activation when light is unavailable. This represents an elegant regulatory system that coordinates ATP synthase activity with photosynthetic electron transport, ensuring energy conservation during dark periods .

Significantly, research has demonstrated that this redox regulation operates via distinct mechanisms from metabolism-induced regulation, as mutations in conserved acidic amino acid residues in the γ subunit alter light-induced but not metabolism-induced regulation .

What expression systems are optimal for producing functional recombinant atpI protein?

For expressing recombinant Fagopyrum esculentum subsp. ancestrale atpI protein, E. coli expression systems have proven effective. The available recombinant protein was expressed in E. coli with an N-terminal His-tag fusion, yielding a functional protein with greater than 90% purity .

The optimal expression protocol involves:

  • Gene synthesis or amplification of the full-length atpI sequence (1-247 amino acids)

  • Cloning into an appropriate expression vector with an N-terminal His-tag

  • Transformation into a compatible E. coli strain optimized for membrane protein expression

  • Induction under controlled temperature conditions (typically 16-25°C) to prevent inclusion body formation

  • Extraction using detergent solubilization methods optimized for membrane proteins

  • Purification via nickel affinity chromatography followed by size exclusion chromatography

For functional studies requiring native protein conformation, researchers should consider incorporation into liposomes or nanodiscs following purification to mimic the membrane environment. This approach helps maintain proper protein folding and activity, which is essential for studying membrane proteins like atpI .

How can researchers differentiate between ATP synthase function in wild versus cultivated buckwheat species?

Distinguishing ATP synthase function between wild Fagopyrum esculentum subsp. ancestrale and cultivated varieties requires multiple complementary approaches:

Comparative Genomic Analysis:
Compare sequence variations in ATP synthase genes, particularly focusing on the genes with elevated evolutionary rates (as indicated by Ka/Ks ratios). The LSC region genes show greater selection pressure and may contain functional adaptations related to ATP synthase regulation .

Structural Analysis:
Utilize transmission electron microscopy (TEM) to examine chloroplast ultrastructure and ATP synthase complex organization. The methodology employed for the lazy1 mutant study in tartary buckwheat provides a template: samples should be fixed with glutaraldehyde, post-fixed with osmium tetroxide, and prepared for TEM following standard protocols .

Biochemical Assays:
Measure ATP synthase activity using isolated chloroplasts or thylakoid membranes from both species. Key parameters to compare include:

  • Proton flux rates

  • ATP synthesis rates under varying light intensities

  • Threshold pmf required for activation

  • Redox regulation sensitivity

Physiological Comparison:
Analyze whole-plant responses that depend on ATP synthase function, such as:

  • Photosynthetic efficiency under fluctuating light conditions

  • Recovery from dark-to-light transitions

  • Response to environmental stresses that affect energy balance

By integrating these approaches, researchers can comprehensively characterize functional differences in ATP synthase between wild and cultivated buckwheat varieties, potentially identifying adaptations that could be valuable for crop improvement .

What methods are appropriate for studying the interaction between atpI and other ATP synthase subunits?

Studying the interactions between atpI and other ATP synthase subunits requires specialized techniques that accommodate the membrane-embedded nature of these proteins. Recommended approaches include:

Co-immunoprecipitation (Co-IP):

  • Express recombinant atpI with an affinity tag (His-tag has proven effective)

  • Solubilize the membrane fraction using mild detergents

  • Perform pull-down assays to identify interacting partners

  • Confirm interactions with western blotting using subunit-specific antibodies

Crosslinking Mass Spectrometry:

  • Apply chemical crosslinkers to stabilize transient protein-protein interactions

  • Digest crosslinked complexes with proteases

  • Analyze resulting peptides using high-resolution mass spectrometry

  • Map crosslinked residues to identify interaction interfaces

Förster Resonance Energy Transfer (FRET):

  • Generate fluorescently labeled ATP synthase subunits

  • Express in appropriate model systems

  • Measure energy transfer between fluorophores to determine proximity

  • Use time-resolved FRET to assess dynamic interactions

Cryo-Electron Microscopy:

  • Isolate intact ATP synthase complexes

  • Prepare samples for cryo-EM analysis

  • Generate 3D reconstructions to visualize subunit arrangements

  • Compare structures under different physiological conditions

When designing these experiments, researchers should consider the distinct regulatory mechanisms of ATP synthase. The established differences between light and metabolism-induced regulation suggest that interaction studies should be conducted under various conditions to capture the full range of conformational states and protein-protein interactions .

How can researchers investigate the role of atpI in chloroplast development and function?

Investigating the role of atpI in chloroplast development and function requires a multifaceted approach combining genetic, biochemical, and physiological techniques:

CRISPR/Cas9 Gene Editing:
Generate targeted mutations in the atpI gene to create plants with altered ATP synthase function. Strategic mutations should target:

  • Transmembrane domains involved in proton translocation

  • Regions implicated in subunit interactions

  • Conservation-variable regions identified through comparative genomics of wild and cultivated buckwheat

Chloroplast Ultrastructure Analysis:
Examine chloroplast morphology in wild-type and atpI-modified plants using transmission electron microscopy following protocols similar to those used in the lazy1 mutant study . Key features to assess include:

  • Thylakoid membrane organization

  • Granum stacking

  • ATP synthase particle distribution

Photosynthetic Parameter Measurements:
Quantify photosynthetic efficiency parameters in plants with altered atpI:

  • Chlorophyll fluorescence (Fv/Fm, NPQ)

  • Proton motive force using electrochromic shift measurements

  • ATP/ADP ratios under varying light conditions

  • Electron transport rates

Phytohormone Analysis:
Assess potential connections between atpI function and hormone signaling using high-performance liquid chromatography to measure hormone levels (particularly auxin and gibberellin) as demonstrated in the lazy1 mutant study methodology :

  • Mobile phase: methanol and aqueous acetic acid solution

  • Flow rate: 0.8 ml/min for IAA, 10 ml/min for GA₃

  • Detection wavelengths: 275/345 nm for IAA, 254 nm for GA₃

What purification strategies yield the highest purity and activity for recombinant atpI?

Purifying recombinant atpI protein while maintaining its native structure and function requires specialized approaches due to its membrane-embedded nature. Based on the successful production of His-tagged recombinant atpI with >90% purity , the following optimized purification protocol is recommended:

Extraction and Solubilization:

  • Harvest E. coli cells expressing atpI-His by centrifugation (6,000×g, 15 min, 4°C)

  • Resuspend cell pellet in lysis buffer containing protease inhibitors

  • Disrupt cells using sonication or pressure-based methods

  • Isolate membrane fraction by ultracentrifugation (100,000×g, 1 h, 4°C)

  • Solubilize membranes using a mild detergent (recommended starting points):

    • 1% n-dodecyl-β-D-maltoside (DDM)

    • 1% digitonin

    • 2% lauryl maltose neopentyl glycol (LMNG)

Affinity Chromatography:

  • Load solubilized sample onto Ni-NTA resin equilibrated with binding buffer containing the selected detergent at its critical micelle concentration (CMC)

  • Wash extensively with increasing imidazole concentrations (10-40 mM) to remove non-specific binding

  • Elute with 250-300 mM imidazole in buffer containing detergent at CMC

Size Exclusion Chromatography:

  • Concentrate affinity-purified protein using a 10 kDa MWCO concentrator

  • Load onto a Superdex 200 column equilibrated with buffer containing detergent at CMC

  • Collect fractions and analyze by SDS-PAGE and western blotting

Quality Assessment:

  • Verify protein identity using mass spectrometry

  • Assess purity by SDS-PAGE (target >95%)

  • Confirm proper folding using circular dichroism spectroscopy

  • Test function by reconstituting purified protein into liposomes and measuring proton transport

For long-term storage, lyophilization has proven effective for preserving atpI protein stability, as indicated by the available recombinant product format .

How can researchers accurately measure ATP synthase activity in isolated chloroplasts?

Accurately measuring ATP synthase activity in isolated chloroplasts requires careful sample preparation and specialized techniques to maintain organelle integrity. The following methodological approach is recommended:

Chloroplast Isolation:

  • Harvest young buckwheat leaves (preferably 10-14 days after germination)

  • Homogenize in ice-cold isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl₂, 1% BSA)

  • Filter through 4 layers of cheesecloth and 1 layer of Miracloth

  • Purify chloroplasts by centrifugation on Percoll gradients (40%/80% interface)

  • Collect intact chloroplasts and resuspend in reaction buffer

ATP Synthesis Measurement:

  • Prepare reaction mixture containing:

    • Resuspended chloroplasts (50 μg chlorophyll/ml)

    • 50 mM HEPES-KOH (pH 8.0)

    • 10 mM MgCl₂

    • 10 mM NaHCO₃

    • 2 mM ADP

    • 5 mM Na₂HPO₄

    • Luciferin/luciferase ATP detection system

  • Dark-adapt chloroplasts for 10 minutes

  • Illuminate samples with defined light intensities (50-1000 μmol photons m⁻² s⁻¹)

  • Monitor ATP production in real-time using a luminometer

  • Calculate ATP synthesis rates normalized to chlorophyll content

Proton Gradient Measurement:

  • Load isolated chloroplasts with fluorescent pH indicator (such as 9-aminoacridine)

  • Monitor fluorescence quenching during illumination as an indicator of ΔpH formation

  • Correlate ΔpH development with ATP synthesis rates

  • Use ionophores (nigericin, valinomycin) as controls to distinguish between ΔpH and ΔΨ components

Inhibitor Studies:

  • Use specific inhibitors to verify ATP synthase contribution:

    • Oligomycin (binds to F₀ sector)

    • Tentoxin (inhibits catalytic activity)

    • Dithiothreitol (DTT) (reduces regulatory disulfides)

  • Monitor activity changes to differentiate between light and metabolism regulation as described in previous research

This comprehensive approach provides accurate measurement of ATP synthase activity while allowing researchers to distinguish between different regulatory mechanisms affecting the enzyme in wild and cultivated buckwheat species .

How has the atpI gene evolved within the Fagopyrum genus?

The evolution of the atpI gene within the Fagopyrum genus reflects broader patterns of chloroplast genome evolution observed across buckwheat species. Comparative genomic analysis provides insights into these evolutionary dynamics:

Conservation Patterns:
The chloroplast genome, including the atpI gene, shows greater conservation in the Inverted Repeat (IR) regions compared to the Large Single Copy (LSC) and Small Single Copy (SSC) regions. This differential conservation is attributed to frequent recombination events in the IR region that maintain sequence homogeneity through gene conversion mechanisms .

Selection Pressure Analysis:
Calculation of synonymous (Ks) and non-synonymous (Ka) substitution rates reveals important patterns in ATP synthase gene evolution:

  • Most ATP synthase genes show high sequence conservation (98% homology) at both nucleotide and amino acid levels

  • Four genes in the LSC region (rpoC2, ycf3, accD, and clpP) demonstrate elevated Ks values, indicating divergent selection pressure

  • The Ka/Ks ratios further support differential selection, with accD, clpP, and ycf3 showing ratios >1.0, indicating positive selection

Structural Variation:
Comparison between Fagopyrum species reveals structural variations that may influence ATP synthase function:

  • InDel (insertion-deletion) events in non-coding regions

  • Tandem repeat copy number variations

  • Palindromic repeat distribution differences

  • These variations could affect gene expression regulation and protein function across species

The evolutionary patterns observed in atpI and other ATP synthase genes likely reflect adaptation to different environmental conditions experienced by wild versus cultivated buckwheat species. This evolutionary history provides valuable context for understanding functional differences in the ATP synthase complex across the Fagopyrum genus .

What structural differences exist in the ATP synthase complex between Fagopyrum species?

Structural differences in the ATP synthase complex between Fagopyrum species reflect adaptations to different ecological niches and cultivation conditions. These differences manifest at multiple levels:

Genetic Basis:
The chloroplast genomes of Fagopyrum tataricum and Fagopyrum esculentum exhibit several structural variations that may influence ATP synthase structure and function:

  • The total chloroplast genome of F. tataricum (159,272 bp) is 327 bp shorter than F. esculentum

  • Variations in tandem repeat frequencies and junction areas

  • Seven InDels (approximately 100 bp each) found within intergenic sequences

  • Copy number variation in 21-bp tandem repeats: four repeats in F. tataricum versus one repeat in F. esculentum

Regulatory Elements:
Differences in palindromic repeats between species may affect gene expression regulation:

  • Three palindromic repeats identified in F. tataricum

  • Four palindromic repeats identified in F. esculentum

  • Variation in loop sizes of shared palindromic repeats

  • These regulatory element differences likely influence ATP synthase subunit expression levels and stoichiometry

Protein Structure Implications:
While the core catalytic domains of ATP synthase remain highly conserved, variations in certain subunits may alter:

  • Proton translocation efficiency

  • Regulatory thresholds for activation

  • Redox sensitivity

  • Interaction with other photosynthetic complexes

Functional Consequences:
These structural differences potentially manifest as functional adaptations:

  • Different ATP synthesis rates under varying light conditions

  • Altered thresholds for light activation

  • Variable responses to environmental stresses (drought, temperature fluctuations)

  • Species-specific energy allocation strategies

Understanding these structural differences provides valuable insights for both evolutionary biology and agricultural applications, potentially identifying advantageous traits for crop improvement programs targeting energy efficiency in buckwheat varieties .

How can atpI variants be utilized to improve photosynthetic efficiency in crops?

Utilizing atpI variants to enhance photosynthetic efficiency in crops represents a promising approach for agricultural improvement. Based on the available research on ATP synthase structure and function in buckwheat species, several strategic approaches emerge:

Regulatory Threshold Modification:
Engineering atpI variants with altered activation thresholds could optimize ATP synthase function under different light conditions:

  • Reducing the pmf threshold required for activation could improve efficiency under low light

  • Carefully calibrated mutations in the transmembrane domain could alter proton sensing

  • Engineering variants based on wild buckwheat (Fagopyrum esculentum subsp. ancestrale) may provide adaptations suitable for diverse environmental conditions

Redox Regulation Engineering:
Modifying the redox regulation of ATP synthase by targeting interacting components:

  • Introducing specific mutations that mimic the effect of acidic amino acid residues in the γ subunit that affect light-induced regulation

  • These modifications could be designed based on the understanding that light and metabolism regulation operate via distinct mechanisms

Expression Level Optimization:
Adjusting atpI expression levels to optimize ATP synthase stoichiometry:

  • Utilizing promoter modifications informed by the palindromic repeat variations observed between wild and cultivated buckwheat species

  • Creating balanced expression of all ATP synthase subunits to maximize complex assembly and function

Cross-Species Hybridization:
Transferring beneficial atpI alleles from wild to cultivated species:

  • Identifying naturally occurring variants with superior properties

  • Using precision breeding or genetic engineering to incorporate these variants

  • Focusing particularly on regions showing evidence of positive selection (high Ka/Ks ratios)

Implementation of these strategies requires careful phenotypic assessment using methods similar to those employed in the lazy1 mutant study, including hormone level analysis and ultrastructural examination . Success would be measured through improvements in photosynthetic parameters, biomass production, and stress tolerance under field conditions.

What role does ATP synthase play in buckwheat adaptation to environmental stresses?

ATP synthase plays a pivotal role in buckwheat adaptation to environmental stresses by regulating energy production and allocation under challenging conditions. The evidence from comparative studies of wild and cultivated buckwheat species provides insights into these adaptive mechanisms:

Drought Stress Adaptation:
Under water-limited conditions, ATP synthase regulation is critical for:

  • Maintaining efficient ATP production with restricted electron transport

  • Preventing excessive reactive oxygen species generation

  • Balancing energy allocation between growth and stress responses

The different selection pressures observed in ATP synthase genes between wild and cultivated buckwheat (evidenced by varying Ka/Ks ratios) suggest adaptations specific to water availability in their native environments .

Light Intensity Fluctuations:
ATP synthase adjustment to varying light conditions involves:

  • Rapid modulation of activation thresholds through redox regulation

  • Controlled proton flux to prevent photodamage during high light exposure

  • Efficient energy capture during low light periods

The distinct regulatory mechanisms for light and metabolic control identified in previous research suggest sophisticated adaptation to fluctuating light environments .

Temperature Stress Response:
Under temperature extremes, ATP synthase function is modified through:

  • Altered membrane fluidity affecting proton translocation

  • Adjusted redox regulatory mechanisms to maintain appropriate activity

  • Modified protein-protein interactions within the complex

Gravitropic Responses:
Research on the lazy1 mutant in Fagopyrum tataricum reveals connections between energy metabolism and developmental responses to gravity:

  • Altered hormone levels (IAA and GA₃) in gravitropic responses

  • Changes in cell ultrastructure associated with stem bending

  • These responses likely involve ATP synthase-mediated energy provision for differential growth

Understanding these adaptation mechanisms provides valuable targets for crop improvement, particularly for enhancing resilience to climate change-related stresses. The natural variations in ATP synthase genes between wild and cultivated buckwheat represent an untapped genetic resource for developing more stress-tolerant crop varieties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.