Recombinant Fagopyrum esculentum subsp. ancestrale NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLLISSVIPILAFLLSGILAPIRKDPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and amino acid composition of Fagopyrum esculentum subsp. ancestrale ndhC?

The ndhC protein from Fagopyrum esculentum subsp. ancestrale is a full-length protein comprising 120 amino acids . Its amino acid sequence is: MFLLYEYDIFWAFLLISSVIPILAFLLSGILAPIRKDPEKLSSYESGIEPIGDAWLQFRIIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIFVLILIVGLVYAWRKGALEWS . Structurally, this protein contains hydrophobic transmembrane domains that anchor it within the thylakoid membrane of chloroplasts . The recombinant version is typically produced with an N-terminal His-tag to facilitate purification and experimental manipulation . Analysis of its sequence reveals characteristic features of membrane-spanning regions typical of the NAD(P)H dehydrogenase complex components .

How does the recombinant ndhC protein differ from its native form?

The recombinant ndhC protein differs from its native form primarily in the addition of an N-terminal His-tag, which facilitates protein purification through metal affinity chromatography . When expressed in E. coli, the recombinant protein may lack post-translational modifications present in the native plant protein, potentially affecting certain functional characteristics . Additionally, the recombinant protein is typically produced in a soluble form, whereas the native protein is embedded in the thylakoid membrane of chloroplasts . This structural context difference may impact protein folding and functional studies, requiring careful experimental design when extrapolating results to in vivo systems . Researchers should be aware that the biochemical properties observed in vitro might not perfectly reflect the protein's behavior in its native chloroplastic environment .

What are the optimal conditions for reconstitution and storage of recombinant ndhC protein?

For optimal reconstitution of lyophilized recombinant ndhC protein, it should be briefly centrifuged prior to opening to collect the contents at the bottom of the vial . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, addition of 5-50% glycerol (final concentration) is recommended, with 50% being the standard concentration used by suppliers . After reconstitution, the solution should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C or -80°C for long-term preservation . For working solutions, aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this can lead to protein denaturation and loss of activity . The storage buffer typically contains Tris/PBS with 6% trehalose at pH 8.0, which helps maintain protein stability .

What are the key considerations for designing activity assays for NAD(P)H-quinone oxidoreductase?

When designing activity assays for NAD(P)H-quinone oxidoreductase, researchers should consider several critical factors. The enzyme catalyzes electron transfer from NAD(P)H to various electron acceptors including quinones, requiring both NAD(P)H and appropriate electron acceptors in the reaction mixture . The standard assay typically monitors the decrease in absorbance at 340 nm due to NAD(P)H oxidation or the reduction of artificial electron acceptors like cytochrome c or dichlorophenolindophenol (DCIP) .

The reaction buffer composition significantly affects enzyme activity, with optimal pH typically in the range of 7.0-7.5 . Researchers should carefully control the concentrations of substrates, as NAD(P)H can act as both a substrate and an inhibitor at high concentrations . Temperature control is essential, with most assays performed at 25-30°C . When working with the recombinant protein, the presence of the His-tag may influence kinetic parameters, necessitating comparison with tag-cleaved versions for definitive studies . Additionally, the enzyme exhibits negative cooperativity towards some inhibitors like dicoumarol, which should be considered when interpreting inhibition studies .

What purification strategies are most effective for recombinant His-tagged ndhC protein?

The most effective purification strategy for His-tagged ndhC protein utilizes immobilized metal affinity chromatography (IMAC), typically with Ni²⁺-NTA or Co²⁺-based resins that bind the His-tag with high affinity . The purification protocol should begin with cell lysis under conditions that maintain protein solubility, often requiring the addition of mild detergents like Triton X-100 or DDM to solubilize this membrane-associated protein .

A typical purification workflow includes:

  • Bacterial cell lysis in a buffer containing 20-50 mM Tris-HCl (pH 8.0), 300-500 mM NaCl, 5-10 mM imidazole, and appropriate protease inhibitors

  • Clarification by centrifugation at ≥20,000g for 30 minutes

  • Binding to Ni²⁺-NTA resin in batch or column format

  • Washing with increasing imidazole concentrations (20-50 mM) to remove non-specific binding proteins

  • Elution with high imidazole concentration (250-300 mM)

  • Buffer exchange to remove imidazole via dialysis or gel filtration

For higher purity requirements, a secondary purification step such as ion exchange chromatography or size exclusion chromatography may be necessary . The final purified protein should be assessed for purity by SDS-PAGE (typically >90% purity is achievable) and stored with glycerol at -20°C or -80°C .

How does ndhC function within the context of the complete NAD(P)H dehydrogenase complex?

Within the complete NAD(P)H dehydrogenase complex, ndhC functions as one of the membrane-embedded subunits that forms part of the proton-translocating apparatus . The protein contributes to the formation of the hydrophobic domain of the complex that spans the thylakoid membrane in chloroplasts . This complex catalyzes the transfer of electrons from NAD(P)H to plastoquinone, coupled with proton translocation across the membrane, thereby contributing to the proton gradient used for ATP synthesis .

The complete NAD(P)H dehydrogenase complex in chloroplasts consists of multiple subunits organized into three subcomplexes: the membrane subcomplex (containing ndhC), the peripheral subcomplex facing the stroma, and the lumenal subcomplex . NdhC specifically contributes to quinone binding and electron transfer within the membrane domain . The coordinated action of all subunits allows for efficient electron transfer and proton pumping, with ndhC positioned strategically to participate in these processes . Disruption of ndhC function can impair the entire complex's activity, affecting cyclic electron flow around photosystem I and plant responses to environmental stresses .

What methods are available for measuring electron transfer activity involving ndhC?

Several methods can be employed to measure electron transfer activity involving ndhC as part of the NAD(P)H dehydrogenase complex. A common approach is the NADPH-dependent cytochrome c reductase assay, which monitors the electron transfer chain: NADPH → FNR → Fd/Fld → cytochrome c . This assay tracks the reduction of cytochrome c spectrophotometrically at 550 nm . The kinetic parameters obtained from such assays provide valuable insights into the electron transfer efficiency, with reported values for similar systems showing tissue-specific variations in Km and kcat values .

  • EPR (Electron Paramagnetic Resonance) spectroscopy to detect the formation of semiquinone intermediates during electron transfer

  • Fluorescence quenching assays to monitor NADPH binding and oxidation

  • Artificial electron acceptors like dichlorophenolindophenol (DCIP) or ferricyanide to assess partial electron transfer reactions

These methods can be combined with site-directed mutagenesis of ndhC to understand the contribution of specific amino acid residues to the electron transfer process .

What role does ndhC play in plant stress responses and adaptation mechanisms?

The ndhC subunit, as part of the NAD(P)H dehydrogenase complex, plays crucial roles in plant stress responses and adaptation mechanisms . During environmental stresses such as high light, drought, or temperature extremes, the NAD(P)H dehydrogenase complex containing ndhC contributes to several protective mechanisms:

  • Photoprotection: The complex facilitates cyclic electron flow around photosystem I, which dissipates excess excitation energy and prevents photo-oxidative damage under high light conditions

  • Redox balance: By modulating the NADPH/NADP+ ratio in chloroplasts, the complex helps maintain cellular redox homeostasis during stress, supporting antioxidant systems that combat reactive oxygen species

  • Energy conservation: Under conditions where linear electron flow is limited (e.g., drought-induced stomatal closure), the cyclic electron flow mediated by this complex helps generate additional ATP without net NADPH production, optimizing the ATP:NADPH ratio for metabolic needs

Research has shown that plants with altered expression of NAD(P)H dehydrogenase components, including ndhC, often exhibit modified tolerance to environmental stresses . The complex's activity can be regulated in response to changing environmental conditions, suggesting its adaptive significance . In Fagopyrum species, which include stress-tolerant varieties, this complex may contribute to their ability to thrive in marginal agricultural conditions .

How can protein-protein interaction studies reveal the functional assembly of the NAD(P)H dehydrogenase complex?

Protein-protein interaction studies provide crucial insights into the assembly and function of the NAD(P)H dehydrogenase complex containing ndhC. Advanced methodologies for investigating these interactions include:

  • Co-immunoprecipitation (Co-IP) combined with mass spectrometry to identify interacting partners of ndhC within the complex

  • Yeast two-hybrid (Y2H) screening to map binary interactions between ndhC and other subunits, revealing assembly hierarchies and essential interaction domains

  • Förster Resonance Energy Transfer (FRET) or Bimolecular Fluorescence Complementation (BiFC) to visualize interactions in planta, providing spatial and temporal information about complex formation

  • Chemical cross-linking followed by mass spectrometry to capture transient interactions and determine proximity relationships between subunits

  • Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) to measure binding affinities and thermodynamic parameters of interactions

These approaches have revealed that the membrane domain containing ndhC interacts specifically with other hydrophobic subunits to form the membrane-embedded portion of the complex . Furthermore, these studies have shown that proper assembly requires coordinated expression of multiple subunits, with ndhC playing a structural role in organizing the quinone binding site . Understanding these interactions is crucial for engineering enhanced photosynthetic efficiency in crop plants .

What insights do comparative studies between different Fagopyrum species provide about ndhC evolution?

Comparative studies between different Fagopyrum species offer valuable insights into ndhC evolution and functional adaptation. Research examining genetic variation among Fagopyrum species has revealed interesting patterns relevant to ndhC evolution . Studies have shown that autogamous species like F. tataricum exhibit lower frequencies of observed SNPs compared to allogamous species such as F. dibotrys and F. esculentum . This genetic diversity pattern suggests different evolutionary pressures affecting the plastid genome, including genes encoding components of the NAD(P)H dehydrogenase complex .

The phylogenetic relationships inferred from sequence comparisons indicate that F. tataricum has two distinct groups, one of which is closely related to F. dibotrys . This evolutionary relationship may reflect adaptations to specific environmental niches, potentially influencing the function of photosynthetic complexes including those containing ndhC . The consistent pattern of SNPs across different Fagopyrum species highlights the phylogenetic importance of these markers .

Interestingly, while some SNPs identified in F. tataricum did not result in amino acid changes, those in other species caused both conservative and non-conservative variations, suggesting different selective pressures on protein function across species . These comparative studies provide context for understanding how natural selection has shaped the structure and function of ndhC in relation to specific environmental adaptations in different Fagopyrum species .

How can site-directed mutagenesis of ndhC inform structure-function relationships?

Site-directed mutagenesis of ndhC provides powerful insights into structure-function relationships within this important chloroplast protein. By systematically altering specific amino acid residues, researchers can determine their contributions to protein stability, membrane integration, quinone binding, and electron transfer . Key approaches include:

  • Mutation of conserved residues in predicted transmembrane domains to assess their role in membrane anchoring and protein stability

  • Alteration of potential quinone-binding residues identified through sequence alignment with bacterial homologs to determine their contribution to substrate specificity and catalytic activity

  • Introduction of reporter residues (e.g., cysteine residues for disulfide cross-linking or fluorescent labeling) to probe conformational changes during the catalytic cycle

  • Creation of chimeric proteins with corresponding subunits from other species to identify domains responsible for species-specific functional characteristics

  • Mutation of residues at subunit interfaces identified from interaction studies to understand assembly requirements and complex stability

These mutagenesis studies have revealed that certain amino acid positions are critical for quinone binding and reduction, while others are essential for proper folding and integration into the membrane . The functional effects of mutations can be assessed using the activity assays described earlier, correlating structural features with specific aspects of enzyme function . Such structure-function studies are essential for understanding how ndhC contributes to photosynthetic efficiency and stress responses .

What are the major challenges in expressing and purifying functional ndhC protein?

Expressing and purifying functional ndhC protein presents several significant challenges. As a hydrophobic membrane protein, ndhC has intrinsic properties that complicate conventional expression and purification approaches . The major challenges include:

  • Protein solubility issues: The hydrophobic nature of ndhC often leads to aggregation, inclusion body formation, or protein misfolding during heterologous expression in E. coli

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to reduced cell viability and protein yields

  • Cofactor incorporation: Ensuring proper incorporation of essential cofactors during recombinant expression can be challenging but critical for obtaining functionally active protein

  • Maintaining native conformation: The protein may adopt non-native conformations in the absence of other complex components or when removed from the lipid bilayer environment

  • Preserving stability during purification: The protein may be unstable once extracted from membranes, requiring careful optimization of detergent types and concentrations

To address these challenges, researchers have developed specialized approaches including:

  • Using mild detergents or amphipols to maintain protein solubility and native-like conformation

  • Employing specialized E. coli strains designed for membrane protein expression

  • Co-expressing with chaperones to improve folding

  • Using fusion partners that enhance solubility

  • Developing liposome reconstitution methods to study the protein in a membrane-like environment

How can researchers distinguish between specific ndhC activity and other NAD(P)H-dependent enzymes?

Distinguishing specific ndhC activity from other NAD(P)H-dependent enzymes requires careful experimental design and multiple control approaches. This distinction is crucial because cells contain numerous NAD(P)H-utilizing enzymes that can confound activity measurements . Strategies to achieve specificity include:

  • Immunodepletion or immunoinhibition using antibodies specific to ndhC or the NAD(P)H dehydrogenase complex to selectively remove or inhibit the activity of interest

  • Genetic approaches utilizing knockout/knockdown systems where ndhC expression is specifically reduced or eliminated, allowing comparison with wild-type systems

  • Inhibitor profiling with compounds that differentially affect various NAD(P)H-dependent enzymes, such as dicoumarol which inhibits NQO1 but has different effects on other enzymes

  • Substrate specificity analysis exploiting the preference of different enzymes for specific electron acceptors or NAD(P)H analogues

  • Kinetic differentiation based on distinct kinetic parameters (Km, Vmax) and cooperativity patterns that can distinguish between enzyme classes

For example, NQO1 shows negative cooperativity towards inhibitors like dicoumarol, which can be used as a distinctive kinetic signature . The FNR-Fd electron transfer system demonstrates tissue-specific kinetic parameters that differ from those of NQO1, providing another means of differentiation . By combining multiple approaches, researchers can confidently attribute observed activities to ndhC within the complex .

What considerations are important when designing experiments to study ndhC in different model systems?

When designing experiments to study ndhC across different model systems, researchers must account for several important considerations to ensure valid comparisons and interpretations:

  • Genetic diversity and conservation: The degree of sequence conservation of ndhC varies across species, with specific domains being more highly conserved than others . Experimental designs should account for these differences when targeting specific regions for mutation or when developing detection reagents like antibodies .

  • Expression system compatibility: Different expression systems may yield proteins with varying post-translational modifications, folding patterns, and activities . Researchers should carefully select systems that best mimic the native environment of the protein from the species being studied .

  • Functional context: The NAD(P)H dehydrogenase complex functions differently across species and even tissues within the same species . For example, maize root FNR (RFNR) has a higher Km value for ferredoxin I than for ferredoxin III, indicating tissue-specific adaptations . These functional differences must be considered when extrapolating findings across systems.

  • Environmental factors: The activity and expression of ndhC can be significantly affected by environmental conditions such as light intensity, temperature, and stress factors . Experimental conditions should be standardized or explicitly varied to account for these effects.

  • Evolutionary considerations: The evolutionary relationship between different Fagopyrum species affects the genetic diversity of plastid genes including ndhC . Studies have shown that breeding systems (autogamous vs. allogamous) influence SNP frequency, which should be considered when comparing results across species .

  • Technical adaptations: Different model systems may require specific technical approaches for optimal results. For instance, plant systems might require different extraction buffers or detergents than bacterial systems to maintain protein stability and activity .

By carefully addressing these considerations, researchers can design robust experiments that generate comparable and meaningful data across different model systems, advancing our understanding of ndhC function in diverse contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.