Recombinant Fagopyrum esculentum subsp. ancestrale NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview and Biochemical Characterization

This recombinant protein (UniProt ID: B2XWJ3) is a 101-amino acid polypeptide expressed in E. coli with an N-terminal His-tag for purification . Key specifications include:

PropertyValue
Molecular Weight~11.2 kDa (theoretical)
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with 5–50% glycerol for stability

The protein corresponds to the ndhE gene product, alternatively termed NAD(P)H dehydrogenase subunit 4L or NADH-plastoquinone oxidoreductase subunit 4L .

Functional Role in Chloroplast NDH Complex

The subunit 4L is essential for the NDH complex’s proton-pumping activity, which drives cyclic electron transport during photosynthesis . Key functional attributes include:

RoleMechanism
Electron transferMediates NAD(P)H → plastoquinone redox reactions (EC 7.1.1.2)
Proton translocationCollaborates with subunits H and K to establish thylakoid membrane ΔpH
Stress adaptationSupports PSI-dependent pathways under high-light stress

Structural studies of barley NDH complexes show subunit 4L interacts directly with subunit F, stabilizing the membrane-embedded region .

Evolutionary Conservation and Homology Analysis

Subunit 4L belongs to the FMN-dependent oxidoreductase superfamily, which includes azoreductases . Phylogenetic analysis highlights:

SpeciesSequence IdentityFunctional Conservation
Hordeum vulgare (barley)76%Membrane topology, quinone binding
Arabidopsis thaliana68%NDH complex assembly

The barley homolog (EMDB-31307) confirms conserved residues (e.g., Tyr-27, Arg-85) critical for quinone oxidoreductase activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs during the order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
Shelf life is dependent on numerous factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)
Target Names
ndhE
Target Protein Sequence
MMLEHVLVLSAYLFSIGIYGLITSRNLVRALMCLELILNAVNLNFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGPAIVSAIYRNRKSTRINQSNLLNK
Uniprot No.

Target Background

Function
NDH transfers electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially within a chloroplast respiratory chain. The primary electron acceptor for this enzyme in this species is believed to be plastoquinone. This enzyme couples the redox reaction with proton translocation, thus conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of NAD(P)H-quinone oxidoreductase subunit 4L in Fagopyrum esculentum subsp. ancestrale?

The NAD(P)H-quinone oxidoreductase subunit 4L (NDHE) is a chloroplast-encoded gene found in the plastid genome of Fagopyrum esculentum. The gene encodes a multi-pass membrane protein with three transmembrane segments that functions in electron transport within the chloroplast thylakoid membrane .

In the broader genomic context, F. esculentum has a genome size of approximately 1.2 Gb based on k-mer analysis, which aligns with cytometry estimates of 1.34 Gb . The draft genome sequence assembly (FES_r1.0) consists of 387,594 scaffolds with a total length of 1,177,687,305 bp and an N50 length of 25,109 bp .

The ancestral subspecies (F. esculentum ssp. ancestrale) shows distinct genomic differences from cultivated varieties, particularly in transposable element (TE) abundance . Analysis of genome composition reveals that retrotransposons (RTEs) comprise approximately 64.8% of the F. esculentum genome, with the Athila Ty3/Gypsy family being the most prevalent (42% of all RTEs) . These genomic features provide important context for understanding gene regulation and expression patterns of chloroplastic genes like NDHE.

How has the NAD(P)H-quinone oxidoreductase gene evolved in Fagopyrum species?

Evolutionary analysis of NAD(P)H-quinone oxidoreductase across Fagopyrum species reveals interesting patterns that reflect broader genome evolution. Comparative genomic studies between F. esculentum and F. tataricum show significant differences in genome size and composition that likely impact the genomic context of chloroplast genes.

The F. esculentum genome is significantly larger than that of F. tataricum, primarily due to a higher abundance of retrotransposons (64.8% versus 30.7%) . Analysis of RTE insertion times shows that 26.6% of RTEs in F. esculentum were inserted during the last 0.5 million years, compared to only 9.6% in F. tataricum . This indicates more dynamic recent genome evolution in F. esculentum, which may influence gene expression and regulation patterns.

The evolutionary relationships of genes encoding chloroplastic proteins can be analyzed using phylogenetic approaches, as demonstrated with other buckwheat genes such as granule-bound starch synthase (GBSS) . Such analyses help reveal patterns of selection and conservation of functionally important domains in proteins like NAD(P)H-quinone oxidoreductase.

What structural features define the chloroplastic NAD(P)H-quinone oxidoreductase in Fagopyrum esculentum?

The chloroplastic NAD(P)H-quinone oxidoreductase subunit 4L in F. esculentum is characterized by several key structural features:

  • Transmembrane topology: Similar to its ortholog in Arabidopsis thaliana, the protein contains three transmembrane segments and functions as a multi-pass membrane protein embedded in the chloroplast thylakoid membrane .

  • Size and composition: Based on data from related species, the protein is approximately 101 amino acids in length with a molecular weight of around 11 kDa .

  • Domain organization: As a member of the oxidoreductase family, it likely shares structural similarities with other NAD(P)H oxidoreductases, which typically contain distinct domains for cofactor binding (NAD(P)H) and substrate interaction.

While the precise three-dimensional structure of the F. esculentum protein has not been resolved, related oxidoreductases like NADPH-cytochrome P450 oxidoreductase (CYPOR) feature distinct FAD and FMN domains connected by a flexible hinge . The protein undergoes significant conformational changes during catalysis, with the FMN domain pivoting to facilitate electron transfer to physiological partners .

What is the mechanism of electron transfer in NAD(P)H-quinone oxidoreductase and how does it relate to chloroplast function?

NAD(P)H-quinone oxidoreductase functions within the electron transport chain of chloroplasts, catalyzing the transfer of electrons from NAD(P)H to quinone acceptors. The mechanism of electron transfer follows these steps:

  • NAD(P)H binding: The enzyme binds NAD(P)H through a specific binding domain.

  • Hydride transfer: A hydride ion is transferred from NAD(P)H to a flavin cofactor within the enzyme.

  • Electron transport: The reduced flavin transfers electrons to quinone acceptors through a series of redox reactions.

  • Proton translocation: The electron transfer is coupled to proton movement across the thylakoid membrane.

This process contributes to proton gradient formation across the thylakoid membrane, which is essential for ATP synthesis . The enzyme plays a crucial role in cyclic electron flow around photosystem I and chlororespiration, helping to balance the ATP/NADPH ratio required for carbon fixation and other metabolic processes in the chloroplast.

The enzyme is functionally integrated into the photosynthetic machinery and contributes to the plant's ability to adapt to changing light conditions and environmental stressors.

What expression systems are most effective for producing recombinant NAD(P)H-quinone oxidoreductase from buckwheat?

Several expression systems can be utilized for the production of recombinant NAD(P)H-quinone oxidoreductase from buckwheat, each with distinct advantages:

  • Bacterial expression systems: Escherichia coli is widely used for recombinant protein expression due to its rapid growth, high protein yields, and well-established genetic tools. For NAD(P)H oxidoreductases, E. coli expression systems have been successfully employed, as demonstrated in studies with related enzymes . The protein can be tagged with polyhistidine for efficient purification using affinity chromatography.

  • Mammalian expression systems: Chinese Hamster Ovary (CHO) cells are valuable for expressing recombinant proteins that require post-translational modifications . While more complex and expensive than bacterial systems, mammalian cells can provide proper folding and modifications that may be critical for enzyme function.

  • Plant expression systems: For chloroplast proteins, plant-based expression systems may provide advantages in terms of protein folding and post-translational modifications. Transient expression in Nicotiana benthamiana or stable transformation of Arabidopsis thaliana can be effective approaches.

The choice of expression system should consider factors such as required protein yield, need for post-translational modifications, solubility concerns, and downstream applications.

What purification strategy yields the highest activity of recombinant NAD(P)H-quinone oxidoreductase?

A multi-step purification strategy is typically required to obtain highly active recombinant NAD(P)H-quinone oxidoreductase:

  • Affinity chromatography: For His-tagged recombinant proteins, immobilized metal affinity chromatography (IMAC) using nickel nitrilotriacetate resin is highly effective. Stepwise elution with increasing imidazole concentrations allows for selective purification under non-denaturing conditions .

  • Ion exchange chromatography: Following initial affinity purification, ion exchange chromatography can remove remaining contaminants based on charge differences. For NAD(P)H oxidoreductases, anion exchange columns (e.g., Q-Sepharose) are often effective.

  • Size exclusion chromatography: As a final polishing step, gel filtration can separate oligomeric forms and remove aggregates while changing into the desired buffer composition.

  • Ammonium sulfate fractionation: For crude extracts, ammonium sulfate precipitation can be used as an initial enrichment step. In buckwheat enzyme purification, (NH4)2SO4 fractional precipitation has been shown to increase purification fold by 3.18-fold with enzyme activity recovery of 63.76% .

The purification process should be performed at optimal temperature (typically 4°C) with appropriate protease inhibitors to prevent degradation. Purification success can be monitored by SDS-PAGE, Western blotting, and enzyme activity assays using appropriate electron acceptors.

What assay methods are most reliable for measuring the activity of recombinant buckwheat NAD(P)H-quinone oxidoreductase?

Several robust assay methods can be employed to measure the activity of recombinant NAD(P)H-quinone oxidoreductase:

  • Spectrophotometric assays with artificial electron acceptors:

    • 2,6-Dichloroindophenol (DCIP): The reduction of this blue dye to colorless form can be monitored at 600 nm .

    • Menadione: Functions as a quinone electron acceptor, with activity measured by monitoring NAD(P)H oxidation at 340 nm .

    • Tetrazolium dyes: These become chromogenic upon reduction and provide sensitive detection of enzyme activity .

  • Coupled enzyme assays: For more complex kinetic studies, the NAD(P)H-quinone oxidoreductase reaction can be coupled to another enzymatic reaction whose product is easily detectable.

  • HPLC-based assays: For precise quantification of reaction products, high-performance liquid chromatography can be used to separate and quantify the reduced and oxidized forms of the quinone substrate.

The standard reaction mixture typically includes:

  • Buffer (pH 7.5-8.5)

  • NAD(P)H (50-200 μM)

  • Electron acceptor (10-100 μM)

  • Enzyme sample (0.1-10 μg)

  • Optional additives: salts (e.g., NaCl, KCl), stabilizers

Activity is typically expressed as μmol of substrate converted per minute per mg of protein (specific activity) or as kcat (catalytic constant, s-1).

How do substrate concentration, pH, and temperature affect the catalytic activity of NAD(P)H-quinone oxidoreductase?

The catalytic activity of NAD(P)H-quinone oxidoreductase is significantly influenced by reaction conditions:

  • Substrate concentration effects:

    • The enzyme typically follows Michaelis-Menten kinetics with distinct Km values for NAD(P)H and quinone substrates.

    • For related buckwheat enzymes, optimal substrate concentrations have been determined using response surface methodology, with concentrations around 0.2 mmol/L found to be optimal for some substrates .

    • Substrate inhibition may occur at high concentrations of either NAD(P)H or quinone substrates.

  • pH dependence:

    • NAD(P)H-quinone oxidoreductases typically have a bell-shaped pH profile.

    • For similar oxidoreductases in buckwheat, optimal pH values around 8.7 have been reported .

    • The pH affects both substrate binding and catalytic rate through influence on critical amino acid residues in the active site.

  • Temperature effects:

    • The enzyme activity increases with temperature up to an optimal point (typically 30-35°C for plant enzymes).

    • For buckwheat enzymes, optimal temperatures of approximately 30.8°C have been determined .

    • Higher temperatures lead to protein denaturation and activity loss.

These parameters can be visualized in a response surface analysis, as shown in this representative table based on data for similar enzymes:

Temperature (°C)pHRelative Activity (%)
258.172
258.681
259.179
308.185
308.694
309.192
358.180
358.687
359.182

Optimization of these parameters is essential for accurate enzyme characterization and for comparing enzymes from different sources or variants produced through mutagenesis.

What site-directed mutagenesis approaches can be applied to study the structure-function relationship of buckwheat NAD(P)H-quinone oxidoreductase?

Several site-directed mutagenesis strategies can provide valuable insights into the structure-function relationship of buckwheat NAD(P)H-quinone oxidoreductase:

  • Cofactor binding site mutations:

    • Mutating residues involved in NAD(P)H binding can alter substrate specificity or affinity. For example, in related oxidoreductases, mutations such as His-194→Ala have been shown to dramatically increase the Km for NADPH .

    • Systematically altering residues that interact with the nicotinamide ring, ribose, or phosphate groups of NAD(P)H can reveal their contributions to binding energy and specificity.

  • Catalytic site mutations:

    • Targeting conserved residues involved in electron transfer between NAD(P)H and flavin cofactors.

    • Creating mutants with altered electron transfer rates to understand rate-limiting steps in the reaction mechanism.

  • Domain interface mutations:

    • In multi-domain oxidoreductases, creating variants with alterations in the flexible hinge regions that connect domains can provide insights into domain movement dynamics .

    • Deletion or insertion mutations in linker regions can affect inter-domain electron transfer rates.

  • Heterodimer approaches:

    • For dimeric enzymes, creating heterodimers with one wild-type subunit and one mutant subunit can reveal how subunits interact functionally .

    • This approach has demonstrated that in some oxidoreductases, subunits function independently with two-electron acceptors but dependently with four-electron acceptors .

  • Transmembrane segment mutations:

    • For membrane-embedded proteins like NAD(P)H-quinone oxidoreductase subunit 4L, mutations in transmembrane segments can reveal their role in protein stability, membrane association, and potentially proton translocation.

The results of such mutagenesis studies should be analyzed through a combination of kinetic assays, protein stability measurements, and potentially structural studies to build a comprehensive understanding of structure-function relationships.

How can crystallographic studies of recombinant buckwheat NAD(P)H-quinone oxidoreductase advance our understanding of its mechanism?

Crystallographic studies of recombinant buckwheat NAD(P)H-quinone oxidoreductase would provide unprecedented insights into its mechanism through:

  • Active site architecture visualization:

    • High-resolution crystal structures would reveal the precise arrangement of catalytic residues and cofactor binding sites.

    • Understanding the spatial organization of electron transfer components would clarify the reaction mechanism.

  • Conformational dynamics investigation:

    • Structures obtained in different redox states or with various bound ligands could capture different conformational states.

    • Similar to studies of CYPOR, which revealed three distinct extended conformations showing how the FMN domain pivots to facilitate electron transfer .

  • Substrate binding mode determination:

    • Co-crystallization with substrates or substrate analogs would reveal binding interactions and substrate specificity determinants.

    • This information could guide the design of inhibitors or modified enzymes with altered substrate preferences.

  • Protein-protein interaction surfaces identification:

    • Crystal structures would reveal potential interaction surfaces with physiological partners in the electron transport chain.

The crystallization process for membrane proteins like NAD(P)H-quinone oxidoreductase subunit 4L presents significant challenges, including:

  • Extracting the protein from the membrane while maintaining native structure

  • Dealing with conformational heterogeneity

  • Finding appropriate detergents or lipid environments for crystallization

  • Obtaining well-ordered crystals that diffract to high resolution

Successful crystallographic studies of buckwheat trypsin inhibitor (BTI) have demonstrated that buckwheat proteins can form diffraction-quality crystals, and that conformational changes upon ligand binding can be visualized (resolution of 1.84 Å for free BTI and 2.26 Å for BTI-trypsin complex) . Similar approaches might be applied to NAD(P)H-quinone oxidoreductase, potentially involving the use of antibody fragments to stabilize specific conformations.

How do environmental stressors affect the expression and activity of NAD(P)H-quinone oxidoreductase in buckwheat?

Environmental stressors significantly influence the expression and activity of NAD(P)H-quinone oxidoreductase in buckwheat through multiple mechanisms:

  • Oxidative stress response:

    • As an electron transport protein, NAD(P)H-quinone oxidoreductase plays a role in managing electron flow and preventing excessive reactive oxygen species (ROS) formation.

    • Under high light or drought conditions that increase ROS production, the expression and activity of the enzyme may be upregulated to help maintain redox homeostasis.

  • Temperature effects on enzyme function:

    • Both heat and cold stress can alter enzyme activity through direct effects on protein structure and stability.

    • For buckwheat enzymes, optimal temperature for activity has been determined to be approximately 30.8°C , with deviations from this temperature reducing catalytic efficiency.

    • Prolonged exposure to extreme temperatures may induce changes in gene expression to compensate for altered enzyme kinetics.

  • Light-dependent regulation:

    • As a component of the chloroplast electron transport chain, NAD(P)H-quinone oxidoreductase activity may be modulated by light intensity and quality.

    • Changes in the photosynthetic apparatus in response to different light conditions may affect the demand for NAD(P)H oxidation and quinone reduction.

  • Metabolic adaptation:

    • Under conditions that alter carbon metabolism or energy demands, the activity of NAD(P)H-quinone oxidoreductase may be regulated to balance electron flow with metabolic needs.

    • This regulation can occur at transcriptional, translational, or post-translational levels.

Understanding these regulatory mechanisms is essential for developing buckwheat varieties with improved stress tolerance and for optimizing growth conditions for maximum photosynthetic efficiency.

What role does NAD(P)H-quinone oxidoreductase play in buckwheat adaptation to different growth conditions?

NAD(P)H-quinone oxidoreductase contributes significantly to buckwheat adaptation through several physiological roles:

  • Energy metabolism optimization:

    • By participating in electron transport and potentially in cyclic electron flow around photosystem I, the enzyme helps optimize the ATP/NADPH ratio required for carbon fixation under varying light conditions.

    • This flexibility in energy metabolism supports buckwheat's ability to grow in diverse environments, from fertile agricultural lands to harsh mountain regions.

  • Redox homeostasis maintenance:

    • The enzyme helps prevent over-reduction of the photosynthetic electron transport chain during high light or low carbon dioxide conditions.

    • This function is particularly important in buckwheat, which contains various photosensitizing compounds like fagopyrin that can generate reactive oxygen species upon light exposure.

  • Developmental adaptation:

    • Changes in the expression and activity of NAD(P)H-quinone oxidoreductase during different developmental stages may support the transitions between vegetative growth and reproductive phases.

    • These changes could contribute to buckwheat's rapid life cycle, allowing it to complete its development within a short growing season.

  • Environmental stress response:

    • As part of the chloroplast electron transport chain, the enzyme participates in acclimation responses to environmental stressors like drought, temperature extremes, and nutrient limitations.

    • Its role in maintaining photosynthetic efficiency under stress conditions contributes to buckwheat's reputation as a hardy crop that can grow in marginal soils and challenging climates.

The study of NAD(P)H-quinone oxidoreductase and its regulation in buckwheat contributes to our understanding of this nutritionally important crop's adaptation mechanisms and may inform breeding strategies for improved varieties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.