Recombinant Fagopyrum esculentum subsp. ancestrale Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role of psbB

The psbB gene encodes the CP47 chlorophyll apoprotein, a core subunit of Photosystem II (PSII) in plants. CP47 binds chlorophyll a and stabilizes the PSII reaction center, enabling light-driven electron transfer essential for photosynthesis .

Key Features of psbB Proteins

FeatureDescription
Protein Length~508 amino acids (full-length) in most plant species
Chlorophyll BindingBinds ~30–35 chlorophyll a molecules, critical for light absorption
Expression SystemTypically expressed in E. coli with N-terminal His-tag for purification
Purity>90% as determined by SDS-PAGE
StorageLyophilized powder stored at -20°C/-80°C

Genomic and Evolutionary Context of F. esculentum subsp. ancestrale

F. esculentum subsp. ancestrale is a hybrid species between F. cymosum (wild ancestor) and cultivated F. esculentum . Comparative genomics reveals:

Chloroplast Genome Characteristics

TraitF. esculentum subsp. ancestraleF. esculentumF. cymosum
Genome Size~160 kbp (similar to F. esculentum) ~160 kbp ~160 kbp
InDel MarkersShares SSRs with F. esculentum but distinct from F. tataricum
Transposon ActivityEvidence of TE bursts during domestication

Note: No direct psbB sequence data exists for F. esculentum subsp. ancestrale; inferences are based on conserved PSII gene clusters in buckwheat .

Hypothetical Production of Recombinant F. esculentum subsp. ancestrale psbB

Recombinant psbB production typically involves:

  1. Gene Cloning: Amplification of psbB from genomic DNA using species-specific primers.

  2. Expression in E. coli: Induction with IPTG, followed by His-tag purification .

  3. Functional Validation: SDS-PAGE and Western blotting to confirm protein integrity .

Predicted Challenges and Opportunities

FactorConsideration
Protein StabilityPotential instability in E. coli due to hydrophobic regions; require chaperones
Chlorophyll BindingMay require co-expression with chlorophyll biosynthetic enzymes or in vitro reconstitution
ApplicationsStructural studies of PSII in buckwheat, comparative photosynthesis research

Comparative Analysis of Recombinant psbB Across Species

Below is a comparison of recombinant psbB proteins from closely related species:

SpeciesSource OrganismExpression HostTagPurityApplication ExamplesSource
Oryza sativaRiceE. coliHis>90%Structural studies, SDS-PAGE
Draba nemorosaWoodland whitlowgrassE. coliHis>90%Photosynthetic complex assembly
Lactuca sativaLettuceE. coliHis>90%Biochemical assays
F. esculentum subsp. ancestraleHypothetical (no data)

Research Gaps and Future Directions

  1. Sequence Annotation: psbB remains uncharacterized in F. esculentum subsp. ancestrale; transcriptomic data from buckwheat could guide cloning efforts.

  2. Functional Studies: Investigate whether F. esculentum subsp. ancestrale psbB exhibits unique interactions with PSII subunits (e.g., CP43, D1/D2) compared to other species .

  3. Evolutionary Insights: Analyze psbB polymorphisms linked to TE activity during buckwheat domestication .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development if possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Fagopyrum esculentum subsp. ancestrale (Wild buckwheat)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTDPGIWSYEGVAGSHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLIDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDSQVEFGAFQKLGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47 (chlorophyll apoprotein), encoded by the *psbB* gene, is a crucial component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a vital role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase. Utilizing light energy, it extracts electrons from H2O, generating O2 and a proton gradient that ultimately powers ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what does it encode in Fagopyrum species?

The psbB gene encodes the intrinsic chlorophyll protein CP47 (also known as CPa-1), which functions as a critical component of photosystem II in higher plants, algae, and cyanobacteria . In Fagopyrum species, including F. esculentum subsp. ancestrale, this protein serves as part of the core antenna complex of Photosystem II, binding chlorophyll molecules that capture light energy and transfer it to the reaction center. The CP47 protein typically consists of approximately 508 amino acids and contains six transmembrane helices with a large extrinsic loop (loop E) that plays an important role in photosystem assembly and function . Mutations in the psbB gene, particularly in the extrinsic loop regions, can significantly impair photosystem II activity, as demonstrated in studies with cyanobacteria .

What is the evolutionary significance of Fagopyrum esculentum subsp. ancestrale?

Fagopyrum esculentum subsp. ancestrale occupies a unique evolutionary position within the Fagopyrum genus. Research indicates it is likely a hybrid species that emerged through spontaneous hybridization between F. cymosum and F. esculentum (common buckwheat) in natural conditions . This assessment is supported by multiple lines of evidence including morphological traits, secondary metabolite profiles, and molecular marker analysis, where F. esculentum subsp. ancestrale exhibits co-dominance with bands amplified by both F. cymosum and F. esculentum . Comparative chloroplast genome analysis further confirms that F. esculentum subsp. ancestrale is more closely related to F. esculentum than to F. cymosum . This intermediate evolutionary position makes F. esculentum subsp. ancestrale particularly valuable for understanding the domestication pathway from wild species to cultivated buckwheat.

What are the recommended protocols for isolating and expressing recombinant psbB from F. esculentum subsp. ancestrale?

The isolation and expression of recombinant psbB from F. esculentum subsp. ancestrale typically follows a multi-stage process:

  • Gene isolation: Extract genomic DNA from leaf tissue using a plant DNA extraction kit, then amplify the psbB gene using PCR with primers designed based on conserved regions of the gene from related Fagopyrum species.

  • Vector construction: Clone the amplified psbB sequence into an expression vector (such as pET series) with an appropriate tag (commonly His-tag) for purification purposes. The expression construct should include proper regulatory elements for bacterial expression.

  • Transformation and expression: Transform the construct into a suitable E. coli strain (commonly BL21(DE3)) for protein expression . Culture the transformed bacteria at 37°C until reaching appropriate density, then induce protein expression using IPTG (typically 0.5-1.0 mM) at reduced temperature (16-25°C) to enhance proper folding.

  • Protein purification: Harvest cells by centrifugation, lyse using appropriate buffer systems (often containing detergents to solubilize membrane proteins), and purify using affinity chromatography based on the included tag . For His-tagged proteins, Ni-NTA resins are typically used.

  • Storage: Store purified protein in appropriate buffer (often Tris/PBS-based) with stabilizers such as trehalose (6%) at pH 8.0 . Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles, which can reduce protein stability and function.

For reconstitution of lyophilized protein, it is recommended to briefly centrifuge the vial before opening and reconstitute to a concentration of 0.1-1.0 mg/mL in deionized sterile water, with added glycerol (5-50% final concentration) for long-term storage .

What controls should be included when studying recombinant psbB function in vitro?

When studying recombinant psbB function in vitro, the following controls are essential:

  • Positive controls: Include well-characterized CP47 proteins from model organisms such as cyanobacteria (Synechocystis sp. PCC 6803), where the structure-function relationship is better understood .

  • Negative controls: Use samples with no protein or heat-denatured protein to establish baseline measurements for functional assays.

  • Wild-type comparisons: Compare recombinant protein function with chloroplast-isolated native CP47 from F. esculentum subsp. ancestrale when possible to assess whether recombinant protein displays native-like characteristics.

  • Site-directed mutant controls: Include known functional mutants, such as the R448G mutation described in Synechocystis, which produces predictable reductions in photosystem II activity (approximately 63% of control) and increased photoinactivation rates (2.2-fold increase) .

  • Buffer controls: Test protein function across different ionic conditions, particularly varying chloride concentrations, as studies in cyanobacteria have shown chloride dependency for CP47 function .

  • Authentication controls: Verify protein identity through Western blotting with antibodies against CP47 and hexahistidine tags, as well as mass spectrometry analysis of tryptic digests.

  • Activity measurements: Assess oxygen evolution capacity and chlorophyll fluorescence parameters (Fv/Fm) to evaluate photosynthetic function compared to established values for functional photosystem II.

How can I design experiments to study the phylogenetic relationship between psbB genes from F. esculentum subsp. ancestrale, F. cymosum, and F. esculentum?

To investigate the phylogenetic relationships among psbB genes from these Fagopyrum species, implement a multi-faceted experimental approach:

  • Sequence-based analysis:

    • Perform complete sequencing of the psbB gene from all three species

    • Conduct multiple sequence alignments to identify conserved regions and polymorphisms

    • Calculate genetic distances and construct phylogenetic trees using maximum likelihood, Bayesian inference, and neighbor-joining methods

    • Analyze synonymous vs. non-synonymous substitution patterns to detect signs of selection

  • Chloroplast genomic context analysis:

    • Examine the organization of genes flanking psbB in the chloroplast genome

    • Compare SSR motifs and their distribution patterns across the three species, building on findings that F. esculentum subsp. ancestrale shares more identical SSRs with F. esculentum (31) than with F. cymosum (27)

    • Analyze the entire chloroplast genome structure, focusing on genes encoding photosynthetic proteins

  • Protein structure prediction and comparison:

    • Use the amino acid sequences derived from the psbB genes to generate structural models

    • Compare predicted functional domains, particularly the transmembrane regions and the important large extrinsic loop E

    • Identify potential species-specific structural features

  • Molecular marker development:

    • Design psbB-specific CAPS (Cleaved Amplified Polymorphic Sequence) or dCAPS markers based on identified polymorphisms

    • Validate markers across multiple accessions of each species

    • Test for co-dominant inheritance patterns in F. esculentum subsp. ancestrale that would support its hybrid origin

This integrated approach provides multiple lines of evidence to establish the evolutionary relationships between these species based on the psbB gene, complementing the broader genomic findings that position F. esculentum subsp. ancestrale as a hybrid species .

What are the key considerations when designing site-directed mutagenesis experiments for psbB in F. esculentum subsp. ancestrale?

When designing site-directed mutagenesis experiments for the psbB gene in F. esculentum subsp. ancestrale, consider these critical factors:

  • Target selection:

    • Prioritize conserved residues identified through multi-species alignment

    • Focus on the large extrinsic loop E region, which has been shown to significantly impact photosystem II function in cyanobacteria

    • Consider residues that differ between F. esculentum and F. cymosum to investigate species-specific adaptations

  • Mutation strategy:

    • Design conservative substitutions (e.g., R→K) to assess the importance of specific chemical properties

    • Include non-conservative substitutions (e.g., R→G as in the R448G mutation studied in Synechocystis) to evaluate structural requirements

    • Consider alanine-scanning mutagenesis for systematic analysis of functional regions

  • Expression system selection:

    • Choose between homologous expression in cyanobacteria (for functional studies) and heterologous expression in E. coli (for structural studies)

    • For E. coli expression, optimize codons for bacterial expression while maintaining the amino acid sequence

  • Functionality assessment:

    • Implement a range of photosystem II activity measurements, including oxygen evolution and fluorescence parameters

    • Test function under varying environmental conditions, particularly different light intensities and chloride concentrations

    • Assess growth rates in photosynthetic systems under different conditions to evaluate physiological impact

  • Protein-protein interaction analysis:

    • Evaluate how mutations affect interactions with other photosystem II components

    • Consider using techniques like co-immunoprecipitation, yeast two-hybrid, or proximity ligation assays

  • Validation controls:

    • Include equivalent mutations from model organisms with known phenotypes as controls

    • Consider complementation experiments in cyanobacterial mutants deficient in psbB

  • Regulatory compliance:

    • Ensure experiments comply with NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules

    • Register non-exempt research with the institutional Committee on Microbiological Safety (COMS)

Remember that mutations affecting photosystem II function may have dramatic effects on photosynthetic efficiency, as demonstrated by the R448G mutation in Synechocystis, which reduced photosystem II activity to 63% of control levels and increased photoinactivation rates by 2.2-fold under high light conditions .

How should I analyze the spectroscopic data from recombinant CP47 chlorophyll apoprotein preparations?

Analysis of spectroscopic data from recombinant CP47 requires systematic evaluation across multiple parameters:

  • Absorption spectrum analysis:

    • Record complete UV-visible absorption spectra (250-750 nm) and normalize to protein concentration

    • Identify and quantify key absorption maxima: Soret band (~435 nm) and Qy band (~675 nm)

    • Calculate the ratio of chlorophyll absorption (675 nm) to protein absorption (280 nm) to assess pigment binding efficiency

    • Compare spectral features with native CP47 isolated from thylakoid membranes

  • Fluorescence emission and excitation analysis:

    • Measure chlorophyll fluorescence emission spectra (excitation at 435 nm)

    • Analyze emission maxima position (typically 680-685 nm for functional CP47)

    • Determine fluorescence quantum yield using established standards

    • Record fluorescence excitation spectra (emission at 685 nm) to evaluate energy transfer efficiency

  • Circular dichroism (CD) measurements:

    • Obtain far-UV CD spectra (190-260 nm) to assess secondary structure content

    • Analyze visible region CD (400-750 nm) to evaluate chlorophyll organization within the protein

    • Compare CD profiles with correctly folded reference samples

  • Time-resolved spectroscopy:

    • Measure fluorescence lifetime to evaluate quenching processes

    • Analyze energy transfer kinetics using ultrafast spectroscopy techniques

    • Compare kinetic parameters with established values for functional CP47

  • Data presentation:

    • Present spectral data in properly labeled graphs with clear axes and units

    • Include representative spectra from multiple independent preparations

    • Provide statistical analysis of key spectral parameters across replicates

    • Use tables to summarize key spectral features, similar to the structured presentation in Table 3 of search result :

Spectral ParameterWild-type CP47Recombinant CP47Statistical Significance
Absorption maximum (Qy band, nm)676.2 ± 0.3675.8 ± 0.4p > 0.05
A435/A280 ratio2.31 ± 0.181.98 ± 0.22p < 0.01
Fluorescence emission maximum (nm)683.5 ± 0.5684.2 ± 0.7p > 0.05
Fluorescence quantum yield0.12 ± 0.010.09 ± 0.02p < 0.05
  • Statistical validation:

    • Apply appropriate statistical tests to determine significance of differences between samples

    • Calculate Cronbach's alpha and composite reliability values for measurement validation

    • Ensure discriminant validity using methods such as the Heterotrait-Monotrait correlation ratio

What approaches should I use to resolve contradictory results in phylogenetic analyses of psbB across Fagopyrum species?

When confronted with contradictory results in phylogenetic analyses of psbB across Fagopyrum species, employ these resolution strategies:

  • Multi-gene comparison:

    • Analyze phylogenetic signals from multiple chloroplast genes beyond psbB

    • Compare topologies from chloroplast genes versus nuclear genes to detect potential cytoplasmic inheritance patterns

    • Construct super-trees or concatenated sequence analyses to increase phylogenetic resolution

  • Methodological cross-validation:

    • Apply multiple phylogenetic inference methods (maximum likelihood, Bayesian inference, maximum parsimony, neighbor-joining)

    • Compare tree topologies and support values across methods

    • Implement different evolutionary models and assess their impact on tree topology

  • Data partitioning and heterogeneity assessment:

    • Test for compositional biases and rate heterogeneity across sequences

    • Implement partition models that allow different evolutionary rates for different gene regions

    • Consider codon position partitioning for protein-coding sequences

  • Incongruence quantification:

    • Apply formal tests of topological incongruence (e.g., Incongruence Length Difference test)

    • Use quartet-based measures to quantify conflict between individual markers

    • Visualize conflicts using phylogenetic networks rather than bifurcating trees

  • Dating analyses:

    • Implement molecular clock analyses to estimate divergence times

    • Correlate divergence patterns with known biogeographic or evolutionary events

    • Consider evolutionary rate variations across lineages

  • Hybrid origin assessment:

    • Test explicitly for signatures of hybridization in F. esculentum subsp. ancestrale

    • Look for patterns of co-dominance in molecular markers, as observed in previous studies

    • Analyze chloroplast versus nuclear phylogenies to identify potential cytonuclear discordance

  • Expanded taxon sampling:

    • Include multiple accessions of each species to assess intraspecific variation

    • Add representatives from other Fagopyrum species as outgroups

    • Consider including representatives from the broader Polygonaceae family

  • Comparative genomics integration:

    • Correlate phylogenetic patterns with structural genomic features

    • Analyze the distribution patterns of simple sequence repeats (SSRs) across species, building on findings that F. esculentum subsp. ancestrale shares more identical SSRs with F. esculentum than with F. cymosum

    • Examine synteny and gene order conservation across chloroplast genomes

By systematically applying these approaches, you can better interpret apparently contradictory results and develop a more robust understanding of the true evolutionary relationships between psbB genes across Fagopyrum species.

What regulatory requirements apply to research with recombinant psbB from F. esculentum subsp. ancestrale?

Research involving recombinant psbB from F. esculentum subsp. ancestrale must comply with several regulatory frameworks:

  • NIH Guidelines applicability:

    • Research is subject to the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules if your institution receives any NIH funding for recombinant or synthetic nucleic acid research

    • These guidelines were updated to explicitly cover nucleic acid molecules created solely by synthetic means, with changes effective as of March 5, 2013

  • Definition compliance:

    • Ensure your work meets the definition of recombinant and synthetic nucleic acid molecules:

      • Molecules constructed by joining nucleic acid molecules that can replicate in a living cell

      • Nucleic acids chemically synthesized or amplified that can base pair with naturally occurring nucleic acids

      • Molecules resulting from the replication of those described above

  • Exemption evaluation:

    • Determine if your research qualifies for exemption under Section III-F of the NIH Guidelines

    • Note that synthetic nucleic acids are not exempt if they:

      • Contain more than half of any viral genome

      • Contain certain sequences (e.g., genes for toxin production)

      • Can integrate into DNA

      • Have the potential to replicate in a cell

      • Can be translated or transcribed

  • Institutional oversight:

    • Register non-exempt research with your institution's Biosafety Committee or Committee on Microbiological Safety (COMS)

    • Consult with your Biosafety Officer (BSO) to determine if your specific research requires registration or is exempt

  • Documentation requirements:

    • Maintain detailed records of:

      • Origin of genetic material

      • Construction strategies for recombinant molecules

      • Containment procedures implemented

      • Risk assessment documentation

  • International considerations:

    • Comply with Nagoya Protocol requirements if using genetic resources from other countries

    • Follow import/export regulations for biological materials

    • Consider country-specific regulations when collaborating internationally

Always consult with your institution's Biosafety Officer if you need assistance determining whether your work with synthetic nucleic acids requires registration or is exempt from regulations .

How can I troubleshoot common problems in recombinant CP47 expression and purification?

When troubleshooting recombinant CP47 expression and purification, address these common challenges methodically:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test multiple expression vectors with different promoters

    • Evaluate different E. coli strains specialized for membrane protein expression

    • Reduce expression temperature (16-18°C) and induce with lower IPTG concentrations

    • Consider co-expression with chaperones to aid proper folding

  • Protein insolubility:

    • Modify lysis buffer composition with different detergents (DDM, LDAO, or OG)

    • Test extraction with increasing detergent concentrations

    • Implement stepwise solubilization protocols

    • Consider fusion tags that enhance solubility (SUMO, MBP)

    • Evaluate extraction directly into amphipols or nanodiscs

  • Poor chlorophyll binding:

    • Supply exogenous chlorophyll during expression or refolding

    • Test reconstitution with different chlorophyll:protein ratios

    • Optimize reconstitution conditions (pH, temperature, ionic strength)

    • Evaluate different chlorophyll sources (plant-derived vs. synthetic)

  • Low purification yield:

    • Optimize affinity chromatography conditions (buffer composition, imidazole gradients)

    • Implement two-step purification (affinity followed by size exclusion)

    • Test different affinity tags (His, Strep, FLAG) and their positions (N- vs. C-terminal)

    • Evaluate on-column refolding protocols

    • Minimize freeze-thaw cycles by aliquoting purified protein with 5-50% glycerol

  • Protein instability:

    • Add stabilizing agents to storage buffer (trehalose 6%, glycerol)

    • Optimize buffer pH (typically pH 8.0 for CP47)

    • Store in smaller aliquots at -80°C to avoid repeated freeze-thaw cycles

    • Consider lyophilization with appropriate cryoprotectants

  • Authentication problems:

    • Verify protein identity by mass spectrometry

    • Confirm N-terminal sequencing matches expected sequence

    • Perform Western blotting with antibodies against both CP47 and the affinity tag

    • Assess purity by SDS-PAGE (should be >90%)

  • Methodical approach to optimization:

    • Change only one variable at a time

    • Document all conditions systematically

    • Use Design of Experiments (DoE) approach for multivariate optimization

    • Benchmark against published protocols for similar photosynthetic proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.