Recombinant Fagus sylvatica Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Chloroplast Envelope Membranes

Chloroplasts rely on intricate biochemical machinery within their envelope membranes for development and functional integration within plant cells . Proteomic analysis has been instrumental in studying these membranes, leading to the identification of numerous proteins .

Proteomic Analysis of Chloroplasts

Proteomics is used to analyze chloroplast envelope membranes to understand their protein composition exhaustively . Researchers have developed methods to purify envelope membranes from plants like Arabidopsis, extract proteins using techniques like chloroform/methanol extraction and alkaline or saline treatments, and then analyze these subfractions using liquid chromatography tandem mass spectrometry . This approach has led to the identification of over 100 proteins, with approximately 80% likely located in the chloroplast envelope .

Functions of Envelope Proteins

Identified proteins are involved in various functions :

  • Ion and metabolite transport.

  • Components of the protein import machinery.

  • Chloroplast lipid metabolism.

Some soluble proteins, such as proteases and proteins involved in carbon metabolism or oxidative stress responses, have also been associated with envelope membranes . A significant portion of these proteins, almost one-third, have unknown functions, highlighting the need for further research .

Dynamics of Plastid Envelope Membranes

Research has explored the dynamic remodeling of plastid envelope membranes using live cell imaging . Alterations in the inner and outer envelope membranes can be observed through the expression of proteins like AtTOC64-GFP and AtTIC40 . Over-expression of envelope membrane proteins can induce membrane proliferation, offering a tool to assess the localization of unknown proteins .

Protein Localization Studies

Fluorescent protein fusions (e.g., GFP) help track the localization of proteins within the chloroplast envelope . These studies revealed that membrane deformations are independent of the function and biochemical properties of the inner envelope proteins but are related to increased protein amounts .

Research on Envelope Membrane Proteins

Studies include analysis of proteins such as AtTPT, AtAPG1, and AtLrgB, which are found in the inner membrane . The localization of AtLACS9 to the outer envelope demonstrates the formation of stromules, which are induced by the over-expression of outer envelope proteins .

Further Research Avenues

To find more specific information on "Recombinant Fagus sylvatica Chloroplast envelope membrane protein (cemA)," consider the following steps:

  1. Search Specific Databases: Explore plant-specific protein databases and conduct a targeted search for Fagus sylvatica (European Beech) chloroplast proteins.

  2. Review Publications on Fagus sylvatica: Look for research articles focusing on the chloroplast proteome of Fagus sylvatica.

  3. Contact Experts: Reach out to plant biologists specializing in chloroplast research, particularly those who have worked on Fagus species.

  4. Monitor Research Updates: Keep an eye on newly published articles and databases for any emerging information on this specific protein.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Fagus sylvatica (Beechnut)
Target Names
cemA
Target Protein Sequence
MAKKKALIPLLYLASIVFLPWWISLSFTKSLESWVTDWWDTGQSEILLNAIQEKSILKKF IELEELFLLDEMIKEYPETHLEKLRIGIYNETIQLIKMHNEDCIYTILHFSTNIICFVIL SSYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKD FGFAHYEQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

How is the cemA gene organized within the chloroplast genome of Fagus sylvatica?

The cemA gene is located within the chloroplast genome of F. sylvatica, which has a quadripartite structure typical of land plants. The complete chloroplast genome of F. sylvatica is remarkably stable in size (158,428 ± 37 bp) across its distribution range .

The structure includes:

  • Large single copy (LSC) region: 87,634-87,706 bp

  • Small single copy (SSC) region: 19,010-19,013 bp

  • Two inverted repeat regions (IR-A/IR-B): 25,873 bp each

The cemA gene is located in the LSC region of the chloroplast genome. Like most chloroplast genes, cemA shows high conservation across F. sylvatica populations, reflecting purifying selection that maintains important biological functions in Fagus chloroplast genomes .

The chloroplast genome of F. sylvatica encodes 131 unique genes, including 81 protein-coding genes (including cemA), 37 tRNA genes, and 8 rRNA genes . This gene content is consistent across Fagus species with only minor variations.

How conserved is the cemA gene across different Fagus species?

Analysis of chloroplast genomes across different Fagus species reveals several important insights about cemA conservation:

  • Sequence conservation: The cemA coding sequence shows high conservation across Fagus species, consistent with the broader finding that purifying selection is the main selective pattern maintaining important biological functions in Fagus chloroplast genomes .

  • Limited polymorphism: Within F. sylvatica populations, chloroplast genome studies identified only 12 microsatellites (SSRs), four SNPs, and one indel in the single copy regions, while inverted repeat regions were monomorphic . This indicates remarkably low genetic diversity within the species.

  • Evolutionary implications: The cemA gene does not appear among the chloroplast genes showing the highest variability within the Fagus genus. The five regions with the largest variations were identified as rps12, rpl32, ccsA, trnW-CCA, and rps3 genes .

This high conservation makes cemA a reliable marker for broader phylogenetic studies but potentially less informative for population-level studies within F. sylvatica.

What protocols are most effective for recombinant expression of F. sylvatica cemA protein?

Successfully expressing recombinant cemA protein requires addressing the challenges of membrane protein expression. The following methodological approach is recommended:

Expression System Selection:

  • E. coli specialized strains: C41(DE3) or C43(DE3) designed specifically for membrane protein expression

  • Yeast systems: Pichia pastoris provides better membrane protein folding environment

  • Insect cell systems: Consider for higher eukaryotic post-translational modifications

Vector Design Optimization:

  • Include a strong, inducible promoter (T7 or IPTG-inducible systems)

  • Incorporate an N-terminal purification tag (His6 or Strep-tag)

  • Consider fusion partners (MBP, SUMO) to improve solubility

Expression Protocol:

  • Transform expression construct into host cells

  • Grow cultures at reduced temperature (16-20°C) after induction

  • Use extended, gentle induction (0.1-0.5 mM IPTG for 16-20 hours)

  • Harvest cells by centrifugation at 4°C

Membrane Fraction Isolation:

  • Lyse cells by sonication or French press in buffer containing protease inhibitors

  • Remove unbroken cells and debris by centrifugation (10,000×g, 20 min)

  • Isolate membranes by ultracentrifugation (100,000×g, 1 hour)

  • Solubilize membrane fraction with appropriate detergents

Based on commercial formulations, the recombinant protein should be stored in Tris-based buffer with 50% glycerol for optimal stability .

How can researchers analyze nuclear insertions of the chloroplast cemA gene in the F. sylvatica genome?

The F. sylvatica nuclear genome contains multiple insertions of chloroplast DNA fragments, creating an important area for cemA research. Notably, chromosome 11 contains a remarkable 2 Mb region with random insertions of chloroplast genome fragments up to 54,784 bp long . This phenomenon has significant implications for cemA research:

Experimental Approach to Differentiate Nuclear vs. Chloroplast cemA:

  • Genomic Analysis:

    • Design primers specific to flanking regions unique to either chloroplast or nuclear contexts

    • Use long-read sequencing (PacBio or Oxford Nanopore) to capture the complete inserted regions

    • Analyze sequence divergence between chloroplast cemA and nuclear copies

  • Expression Analysis:

    • Perform RNA-seq with specific mapping parameters to distinguish transcripts

    • Design RT-PCR assays targeting SNPs that differ between chloroplast and nuclear copies

    • Quantify relative expression of authentic vs. nuclear-inserted copies

  • Functional Validation:

    • Use chloroplast isolation followed by PCR to confirm authentic chloroplast sequences

    • Employ in vitro translation systems to test if nuclear copies produce functional proteins

Research has shown that within-individual analysis of polymorphisms revealed >9,000 markers present in both gene and non-gene areas, but investigation of alternate allele frequencies indicated this diversity originated from nuclear-encoded plastome remnants (NUPTs) . This finding highlights the importance of distinguishing true chloroplast sequence variants from nuclear copies when studying cemA.

What role might cemA play in drought resistance of Fagus sylvatica?

Recent research has established a genomic basis for drought resistance in European beech forests, with genotype playing a more significant role than environment in determining drought susceptibility . While cemA was not specifically identified among the 106 significantly associated SNPs related to drought resistance, its function as a chloroplast membrane protein suggests potential roles in stress response.

Experimental Framework to Investigate cemA in Drought Response:

  • Comparative Expression Analysis:

    • Compare cemA expression levels between drought-resistant and susceptible beech trees

    • Perform time-course analysis during progressive drought stress

    • Use RT-qPCR with appropriate reference genes validated for stress conditions

  • Protein Function Analysis:

    • Investigate cemA protein modifications under drought stress

    • Analyze protein-protein interactions under normal vs. stress conditions

    • Assess membrane integrity and chloroplast function correlations with cemA activity

  • Genetic Association:

    • Screen for cemA sequence polymorphisms in populations with different drought tolerance

    • Test for statistical associations between cemA variants and drought response phenotypes

    • Evaluate chloroplast haplotypes containing cemA variants for correlation with drought resistance

The recombinant cemA protein could serve as a valuable tool for raising antibodies and developing protein interaction assays to further understand its role in drought response mechanisms.

How can researchers study cemA protein interactions in the chloroplast membrane?

Understanding cemA protein interactions is crucial for elucidating its functional role in the chloroplast. The following methodological approaches are recommended:

In Vivo Interaction Analysis Methods:

  • Split-GFP Complementation Assay:

    • Fuse cemA and potential interacting partners to complementary GFP fragments

    • Express in plant protoplasts or tobacco leaves via transient expression

    • Visualize reconstituted fluorescence using confocal microscopy

  • Proximity-Based Labeling:

    • Express cemA fused to BioID or TurboID enzyme in plant systems

    • Allow proximity-dependent biotinylation of neighboring proteins

    • Purify biotinylated proteins using streptavidin and identify by mass spectrometry

  • Co-immunoprecipitation Optimization for Membrane Proteins:

    • Solubilize chloroplast membranes with gentle detergents (digitonin, DDM)

    • Use cemA-specific antibodies or epitope tags for immunoprecipitation

    • Apply crosslinking (DSP or formaldehyde) to stabilize transient interactions

    • Identify co-precipitated proteins by mass spectrometry

Detergent Selection Table for Membrane Protein Studies:

DetergentPropertiesRecommended ConcentrationApplication
DDM (n-Dodecyl β-D-maltoside)Mild, maintains protein structure0.5-1%Initial solubilization
DigitoninVery mild, preserves supercomplexes0.5-2%Co-IP of intact complexes
LDAO (Lauryldimethylamine oxide)Intermediate strength0.1-0.5%Higher stringency wash
Triton X-100Stronger solubilization0.5-1%Complete membrane disruption

Recombinant cemA protein can serve as an essential control in these experiments, particularly for antibody validation and competition assays .

What is the most effective method for isolating intact chloroplasts from Fagus sylvatica to study native cemA?

Isolating intact chloroplasts from Fagus sylvatica presents unique challenges due to the high levels of phenolic compounds and tannins in beech leaves. The following optimized protocol addresses these specific challenges:

Optimized Chloroplast Isolation Protocol for F. sylvatica:

  • Sample Collection and Preparation:

    • Collect young leaves in early morning (before 10 AM)

    • Keep tissues on ice and process within 1 hour of collection

    • Remove midribs and cut leaves into small pieces (≈1 cm²)

  • Homogenization Buffer Composition:

    • 330 mM Sorbitol

    • 50 mM HEPES-KOH (pH 7.8)

    • 2 mM EDTA

    • 1 mM MgCl₂

    • 5 mM sodium ascorbate (fresh)

    • 2% (w/v) polyvinylpyrrolidone (PVP-40)

    • 0.05% BSA

    • 1 mM DTT (added fresh)

    • 1% (w/v) polyvinylpolypyrrolidone (PVPP) (to adsorb phenolics)

  • Homogenization Procedure:

    • Homogenize tissue in cold buffer (4:1 buffer:tissue ratio)

    • Use short pulses in a blender to avoid heating

    • Filter through 4 layers of miracloth

  • Differential Centrifugation:

    • Centrifuge at 200×g for 3 minutes to remove debris

    • Collect supernatant and centrifuge at 1,500×g for 10 minutes

    • Gently resuspend pellet in washing buffer (same as homogenization buffer without PVPP and BSA)

  • Percoll Gradient Purification:

    • Prepare a discontinuous Percoll gradient (40%/80%)

    • Layer chloroplast suspension on gradient

    • Centrifuge at 3,500×g for 20 minutes at 4°C

    • Collect intact chloroplasts at the 40%/80% interface

  • Quality Assessment:

    • Check chloroplast integrity by phase-contrast microscopy

    • Perform Hill reaction assay to confirm functionality

    • Assess purity by measuring marker enzyme activities

This protocol optimizes chloroplast yield and integrity, providing suitable material for subsequent cemA protein studies or chloroplast DNA isolation for cemA gene analysis.

How can researchers quantify cemA expression levels in response to environmental stressors?

Accurate quantification of cemA expression in response to environmental stressors requires careful experimental design and appropriate techniques:

Experimental Design for cemA Expression Analysis:

  • Sampling Strategy:

    • Use matched leaf material from the same branch position

    • Create appropriate environmental treatments (drought, temperature, light stress)

    • Include time-course sampling to capture dynamic responses

    • Maintain minimum 5 biological replicates

  • RNA Extraction Protocol:

    • Use a CTAB-based method with high PVP concentration (2-4%)

    • Include β-mercaptoethanol (2%) to prevent oxidation

    • Perform multiple chloroform extractions to remove contaminants

    • Use silica column purification with additional washing steps

  • RT-qPCR Optimization:

    • Design primers specific to chloroplast cemA (avoiding nuclear copies)

    • Validated primer pairs spanning exon junctions if possible

    • Include multiple reference genes (at least 3) for normalization

    • Use at least 3 technical replicates per biological sample

Reference Gene Selection for F. sylvatica Under Stress Conditions:

GeneFunctionStability Under StressRecommended Use
18S rRNARibosomal RNAHighGeneral normalization
ACT2Cytoskeletal proteinModerateTemperature, light stress
EF1αTranslation factorHighMost stress conditions
UBQUbiquitinHighDrought, salt stress
GAPDHMetabolic enzymeLow-moderateNot recommended for drought

For cemA protein quantification, western blotting with antibodies raised against recombinant cemA protein would complement transcript analysis, providing insight into potential post-transcriptional regulation under stress conditions.

What approaches can be used to study the structural biology of recombinant cemA protein?

Understanding the structure-function relationship of cemA requires specialized approaches for membrane proteins:

Structural Biology Workflow for cemA:

  • Protein Production Optimization:

    • Scale up recombinant expression in the selected system

    • Optimize detergent extraction (screen DDM, LDAO, LMNG, etc.)

    • Implement two-step purification (affinity + size exclusion chromatography)

    • Assess protein homogeneity by analytical ultracentrifugation

  • Protein Quality Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Thermal shift assays to identify stabilizing conditions

    • Dynamic light scattering to verify monodispersity

    • Limited proteolysis to identify stable domains

  • Structural Determination Approaches:

    • X-ray Crystallography:

      • Screen crystallization conditions in lipidic cubic phase

      • Optimize crystal diffraction quality

      • Consider antibody fragment complexation to aid crystallization

    • Cryo-Electron Microscopy:

      • Reconstitute cemA into nanodiscs or amphipols

      • Optimize grid preparation (concentration, detergent)

      • Collect high-resolution images for single-particle reconstruction

    • NMR Spectroscopy:

      • Express isotopically labeled protein (¹⁵N, ¹³C)

      • Optimize detergent micelle size for solution NMR

      • Perform selective labeling to reduce spectral complexity

  • Computational Structural Analysis:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations in membrane environment

    • Docking studies with potential substrates or interactors

The recombinant cemA protein must be maintained in detergent or lipid environments throughout the purification and structural analysis workflow to preserve native-like conformation .

How does the chloroplast genome organization in F. sylvatica impact cemA evolution and function?

The organization of the F. sylvatica chloroplast genome provides important context for understanding cemA evolution and function:

Key Features of F. sylvatica Chloroplast Genome Organization:

  • Genome Structure:

    • The complete 158,428 ± 37 bp chloroplast genome has a quadripartite structure

    • cemA is located in the Large Single Copy (LSC) region

    • The inverted repeat regions show exceptional conservation with no variation in length (25,873 bp) across populations

  • Evolutionary Implications:

    • The chloroplast genome shows remarkable structural stability across F. sylvatica populations

    • Polymorphic markers (12 microsatellites, 4 SNPs, 1 indel) were found only in single copy regions

    • Inverted repeat regions demonstrated "highly efficient suppression of mutation"

  • Genomic Context of cemA:

    • cemA is among 131 unique genes annotated in the F. sylvatica chloroplast genome

    • The chloroplast genome is categorized functionally into photosynthesis genes, self-replication genes, and genes of unknown function

    • Coding regions represent 51% of the LSC region where cemA is located

  • Nuclear-Chloroplast Genome Interactions:

    • Nuclear insertions of chloroplast DNA span more than 2 Mb on chromosome 11

    • These insertions may create evolutionary pressure through gene redundancy

    • Nuclear copies of chloroplast genes can potentially become pseudogenes or evolve new functions

Understanding these genomic features provides context for cemA research, particularly regarding selective pressures on the gene and potential functional redundancy due to nuclear insertions of chloroplast DNA fragments.

What are the key unresolved questions regarding cemA structure and function in F. sylvatica?

Despite recent genomic advances, several critical aspects of cemA biology remain unexplored:

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and evolutionary analysis.

How can cemA research contribute to understanding beech forest adaptation to climate change?

European beech forests face significant challenges from climate change, particularly increased drought frequency and severity. Research on cemA can provide valuable insights into adaptation mechanisms:

  • Physiological Adaptations:

    • Investigate whether cemA variants correlate with photosynthetic efficiency under drought

    • Determine if cemA plays a role in chloroplast membrane stability during heat stress

    • Assess whether cemA function relates to carbon fixation capacity under climate stress

  • Population Genetics Approach:

    • Compare cemA sequences from populations across environmental gradients

    • Identify potential adaptive variants in different climatic regions

    • Use cemA as part of a broader chloroplast haplotype analysis for adaptation studies

  • Integration with Genomic Data:

    • Correlate cemA variation with the 106 SNPs already identified in drought resistance studies

    • Investigate epistatic interactions between nuclear genes and cemA variants

    • Develop predictive models incorporating cemA data for forest vulnerability assessment

  • Applied Conservation Genomics:

    • Use cemA as one marker in a multi-locus approach to identify resilient genotypes

    • Inform forest management and replanting strategies based on genetic insights

    • Develop rapid screening methods for adaptive potential in nursery stock

These approaches could help address the observation that "drought-damaged trees neighboured healthy trees, suggesting that the genotype rather than the environment was responsible for this conspicuous pattern" .

What technological advances would most benefit cemA research in F. sylvatica?

Several technological developments would significantly advance cemA research:

  • Chloroplast-Specific Genome Editing:

    • Development of reliable transformation methods for F. sylvatica chloroplasts

    • Adaptation of CRISPR-Cas9 systems for chloroplast genome editing

    • Techniques for site-directed mutagenesis of cemA in its native context

  • Advanced Imaging Technologies:

    • Super-resolution microscopy to visualize cemA distribution in chloroplast membranes

    • Live-cell imaging tools to track cemA dynamics during stress responses

    • Correlative light and electron microscopy for structural-functional studies

  • Functional Assays:

    • Development of reconstituted proteoliposome systems to study cemA transport activity

    • High-throughput screening methods to identify cemA substrates or inhibitors

    • Biosensors to monitor cemA-related processes in real-time

  • Computational Tools:

    • Improved algorithms for distinguishing chloroplast-encoded vs. nuclear-inserted cemA sequences

    • Advanced structural prediction tools specific for chloroplast membrane proteins

    • Systems biology approaches to model cemA within chloroplast metabolic networks

These technological advances would enable researchers to move beyond genomic descriptions toward mechanistic understanding of cemA function in European beech.

What is the recommended protocol for PCR amplification and cloning of the cemA gene from F. sylvatica?

The following detailed protocol is optimized for amplification and cloning of the cemA gene from F. sylvatica chloroplast DNA:

PCR Amplification Protocol:

  • Template Preparation:

    • Extract total DNA from young leaves using a CTAB method with high PVP concentration

    • Alternatively, use purified chloroplast DNA from the isolation protocol in section 3.1

  • Primer Design:

    • Forward primer: 5'-NNNNNCATATGAAAGCAAAGAAAAAGCTGATTCCG-3' (includes NdeI site)

    • Reverse primer: 5'-NNNNNCTCGAGTCAATTTGTATACATAACAAATAACGG-3' (includes XhoI site)

    • Add appropriate restriction sites based on your expression vector of choice

  • PCR Reaction Setup:

    • Use a high-fidelity DNA polymerase (Q5, Phusion, or PrimeSTAR)

    • Reaction buffer (1X): 5 μL

    • dNTPs (10 mM each): 1 μL

    • Forward primer (10 μM): 1 μL

    • Reverse primer (10 μM): 1 μL

    • Template DNA (50-100 ng): 1 μL

    • DNA polymerase: 0.5 μL

    • DMSO: 1.5 μL (helps with GC-rich template)

    • Nuclease-free water to 50 μL

  • Thermocycling Conditions:

    • Initial denaturation: 98°C for 30 seconds

    • 30 cycles of:

      • Denaturation: 98°C for 10 seconds

      • Annealing: 58°C for 30 seconds

      • Extension: 72°C for 45 seconds

    • Final extension: 72°C for 5 minutes

    • Hold at 4°C

  • Cloning Strategy:

    • Digest PCR product and vector with appropriate restriction enzymes

    • Ligate into expression vector with appropriate fusion tags

    • Transform into competent E. coli cells (DH5α for initial cloning)

    • Screen colonies by colony PCR

    • Verify insert by Sanger sequencing

This protocol specifically addresses the challenges of F. sylvatica DNA amplification and is designed to successfully clone the cemA gene for subsequent recombinant expression studies.

How should researchers approach the purification and analysis of recombinant cemA protein?

Successful purification of recombinant cemA requires specialized approaches for membrane proteins:

Purification Protocol:

  • Cell Lysis and Membrane Fraction Isolation:

    • Resuspend cell pellet in lysis buffer (50 mM Tris pH 8.0, 200 mM NaCl, 10% glycerol, protease inhibitors)

    • Disrupt cells using sonication or French press

    • Remove cellular debris by centrifugation (10,000×g, 20 min, 4°C)

    • Collect membrane fraction by ultracentrifugation (100,000×g, 1 hour, 4°C)

  • Membrane Protein Solubilization:

    • Resuspend membrane pellet in solubilization buffer (50 mM Tris pH 8.0, 200 mM NaCl, 10% glycerol)

    • Add detergent (1% DDM or 1% LMNG) and stir gently for 2 hours at 4°C

    • Remove insoluble material by ultracentrifugation (100,000×g, 30 min, 4°C)

  • Affinity Chromatography:

    • Load solubilized fraction onto Ni-NTA resin (for His-tagged proteins)

    • Wash with buffer containing 20-40 mM imidazole and 0.05% detergent

    • Elute with buffer containing 250 mM imidazole and 0.05% detergent

  • Size Exclusion Chromatography:

    • Concentrate eluted protein using 50 kDa MWCO concentrator

    • Load onto pre-equilibrated Superdex 200 column

    • Collect peak fractions and analyze by SDS-PAGE

  • Protein Quality Assessment:

    • SDS-PAGE analysis (cemA should appear at approximately 25-27 kDa)

    • Western blotting with anti-His antibody or specific anti-cemA antibodies

    • Mass spectrometry for protein identification and purity assessment

Storage Recommendations:

  • Store purified protein at 0.5-1 mg/mL in 50 mM Tris pH 7.5, 150 mM NaCl, 0.03% DDM, 50% glycerol

  • Flash-freeze in small aliquots and store at -80°C

  • Avoid repeated freeze-thaw cycles

This protocol maximizes yield and stability of the recombinant cemA protein for subsequent structural and functional analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.