Recombinant Fasciola hepatica NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Fasciola hepatica (Liver fluke)
Target Names
ND3
Target Protein Sequence
MLFFAVLGLLFFLIFFLVLVFHAFLWNLDLGIFSGERSWVSSFECGFLSQRVTENYFSYT YFILLVFFVVFDLEVSLLLNMPLQGVLYKNFFSYLFFLVLLGIGFLVEVRRGYVRWAY
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), it is considered part of the minimal catalytic assembly. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (ND3) in the context of Fasciola hepatica?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial membrane protein that functions as a component of Complex I in the electron transport chain of F. hepatica. As a parasitic helminth, F. hepatica relies on efficient energy metabolism to support its complex life cycle transitions from newly excysted juveniles (NEJ) through migration in the host to adult stages in the bile ducts. ND3 plays a critical role in proton pumping and energy production, particularly during the parasite's high-energy-demanding migratory phase through host tissues .

How does F. hepatica ND3 differ from homologous proteins in other species?

F. hepatica ND3, unlike its mammalian counterparts, contains unique structural elements that reflect adaptation to the parasite's distinct metabolic requirements. These adaptations may include modifications that allow function under variable oxygen tensions as the parasite transitions from intestinal to liver environments. Sequence comparisons between F. hepatica ND3 and homologs from host species (bovine, ovine, human) typically show approximately 60-75% sequence divergence, making it a potential target for selective inhibition .

What are typical expression systems for producing recombinant F. hepatica ND3?

Expression SystemAdvantagesLimitationsTypical Yield
E. coliCost-effective, rapid growth, well-established protocolsPotential improper folding of membrane proteins, inclusion body formation1-5 mg/L culture
Pichia pastorisBetter folding of eukaryotic proteins, glycosylation capabilityLonger expression time, more complex protocols5-20 mg/L culture
Insect cellsSuperior folding of complex eukaryotic proteinsHighest cost, technical complexity2-10 mg/L culture
Cell-free systemsAvoids toxicity issues with membrane proteinsExpensive, limited scale0.5-2 mg/L reaction
Note: Codon optimization for the chosen expression system is particularly important for F. hepatica proteins due to potential differences in codon usage bias .

What purification strategies are most effective for recombinant F. hepatica ND3?

Purification of recombinant F. hepatica ND3 typically requires a multi-step approach:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin when the protein contains a His-tag, similar to the approach used for other F. hepatica recombinant proteins .

  • Intermediate purification: Ion exchange chromatography to separate based on charge differences.

  • Polishing step: Size exclusion chromatography to achieve high purity and remove aggregates.

  • Detergent considerations: As a membrane protein, ND3 requires appropriate detergents during purification. Typical choices include:

    • n-Dodecyl β-D-maltoside (DDM) at 0.05-0.1% for extraction

    • Reduced detergent concentrations (0.01-0.02%) during chromatography steps
      Western blot analysis using specific antibodies should be performed to confirm protein identity, similar to methods used for detection of native F. hepatica proteins .

How can researchers verify the structural integrity of purified recombinant F. hepatica ND3?

Structural integrity assessment should include:

  • Circular dichroism (CD) spectroscopy: To confirm secondary structure elements

  • Thermal shift assays: To determine protein stability under various buffer conditions

  • Limited proteolysis: To assess compact folding

  • Activity assays: Measuring NADH:ubiquinone oxidoreductase activity using artificial electron acceptors like ferricyanide
    Researchers should also consider analyzing interactions with known Complex I inhibitors to confirm proper folding and function. The mobility pattern on SDS-PAGE gels can provide initial indications of proper folding, with native F. hepatica proteins often showing additional higher molecular weight bands representing protein complexes, as observed with other F. hepatica proteins .

How can recombinant F. hepatica ND3 be used to understand the parasite's energy metabolism during different life stages?

Recombinant F. hepatica ND3 can serve as a valuable tool for understanding stage-specific energy metabolism by:

  • Comparative activity studies: Measuring enzymatic activity under conditions mimicking different host environments (pH 7.4 for blood, pH 6.0-6.5 for intestine, etc.)

  • Inhibitor screening: Identifying compounds that selectively inhibit parasite ND3 without affecting host homologs

  • Protein-protein interaction studies: Using co-immunoprecipitation with antibodies against recombinant ND3 to identify stage-specific interaction partners

  • Developmental expression analysis: Correlating functional activity with transcriptomic data showing differential expression across life stages
    Transcriptomic studies of F. hepatica have shown significant metabolic adaptations during migration through host tissues, with changes in energy metabolism potentially supporting the transition from aerobic to more anaerobic environments .

What are the challenges in expressing functional mitochondrial membrane proteins like ND3 from F. hepatica?

Expression of functional F. hepatica ND3 faces several challenges:

  • Hydrophobicity: The high hydrophobicity of membrane segments can cause aggregation and inclusion body formation

  • Complex assembly: ND3 normally functions as part of the larger Complex I, potentially requiring co-factors or partner proteins

  • Post-translational modifications: Parasitic proteins often exhibit specific modifications that may not be replicated in heterologous systems

  • Toxicity to expression hosts: Overexpression of foreign membrane proteins can disrupt host cell membrane integrity
    Researchers can address these challenges through strategies like:

  • Using fusion partners (MBP, SUMO) to enhance solubility

  • Co-expression with chaperones

  • Cell-free expression systems for highly toxic proteins

  • Membrane mimetics (nanodiscs, liposomes) for functional studies

Can recombinant F. hepatica ND3 serve as a potential vaccine or diagnostic target?

Recombinant F. hepatica ND3 has potential as both a vaccine and diagnostic target:
Vaccine potential:

What analytical methods are recommended for characterizing recombinant F. hepatica ND3?

Analytical TechniqueApplicationExpected Results
Western blottingProtein identification and integritySingle band at ~13 kDa with possible higher-order complexes
Mass spectrometrySequence verification and modificationsPeptide coverage >80% for proper identification
Nano-DSFThermal stability assessmentMelting temperature data in different buffers
BN-PAGENative complex formation analysisHigher-order assemblies if proper folding achieved
Enzyme kineticsFunctional analysisKm and Vmax values for NADH oxidation
ImmunolocalizationTissue distribution studiesPotential concentration around oral/ventral suckers as seen with other F. hepatica proteins

How can researchers troubleshoot low expression or inactivity of recombinant F. hepatica ND3?

Common issues and solutions include:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test multiple fusion tags (His, GST, MBP, SUMO)

    • Reduce expression temperature (16-18°C)

    • Use specialized E. coli strains for membrane proteins (C41, C43)

  • Protein inactivity:

    • Screen multiple detergents for extraction (DDM, LMNG, digitonin)

    • Add phospholipids during purification

    • Include stabilizing agents (glycerol, specific ions)

    • Consider nanodiscs or proteoliposomes for functional studies

  • Protein degradation:

    • Add protease inhibitors throughout purification

    • Reduce purification time

    • Maintain cold temperature throughout
      These approaches parallel methods that have been successful for other complex F. hepatica proteins .

How might recombinant F. hepatica ND3 be used to study drug resistance mechanisms?

Recombinant ND3 can serve as a valuable tool for investigating potential drug resistance mechanisms through:

  • Direct binding studies with anti-parasitic compounds like triclabendazole and its metabolites

  • Site-directed mutagenesis to reproduce mutations observed in resistant isolates

  • Comparative studies between ND3 from susceptible and resistant F. hepatica isolates

  • Drug screening assays using ND3 activity as a readout
    Coupled with transcriptomic data showing differential expression of metabolic pathways in resistant isolates, this can provide insight into potential alternative metabolic strategies employed by resistant parasites .

What immunomodulatory properties might F. hepatica ND3 exhibit?

While primarily a metabolic protein, F. hepatica ND3 may exhibit immunomodulatory effects:

  • Potential PAMPs (Pathogen-Associated Molecular Patterns): Unique structural elements may be recognized by pattern recognition receptors

  • Indirect immunomodulation: Role in energy metabolism may support production of known immunomodulatory molecules

  • Host-pathogen interaction: As an essential protein, antibodies against ND3 could potentially interfere with parasite metabolism
    Transcriptomic studies of F. hepatica infection show significant immune pathway modulation, including IL-10 signaling, Toll-like receptor signaling, TGF-β signaling, and STAT3 pathways, though the specific contribution of ND3 to these effects would require dedicated studies .

How should researchers develop and validate antibodies against recombinant F. hepatica ND3?

Development of high-quality antibodies against recombinant F. hepatica ND3 requires:

  • Immunogen preparation:

    • Use purified recombinant protein with >95% purity

    • Consider both full-length protein and peptide approaches targeting hydrophilic regions

    • Ensure proper folding when possible

  • Validation strategies:

    • Western blot against native parasite extracts from multiple life stages

    • Immunoprecipitation followed by mass spectrometry

    • Immunolocalization in parasite tissues with appropriate controls

    • Pre-adsorption controls to confirm specificity

  • Expected patterns:

    • Detection of ~13 kDa band in parasite extracts

    • Possible additional bands representing complexes or post-translational modifications

    • Localization primarily to mitochondria-rich tissues
      Previous studies with F. hepatica proteins have shown that antibodies may recognize both the target protein (~40 kDa bands) as well as higher molecular weight complexes (~50, ~70, ~100 kDa), which should be considered during validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.