Recombinant Feline coronavirus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
M; 5; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-262
Protein Length
Full Length of Mature Protein
Species
Feline coronavirus (strain FIPV WSU-79/1146) (FCoV)
Target Names
M
Target Protein Sequence
ERYCAMQDSGLQCINGTNSRCQTCFERGDLIWHLANWNFSWSVILIVFITVLQYGRPQFS WLVYGIKMLIMWLLWPIVLALTIFNAYSEYQVSRYVMFGFSVAGAVVTFALWMMYFVRSV QLYRRTKSWWSFNPETNAILCVNALGRSYVLPLDGTPTGVTLTLLSGNLYAEGFKMAGGL TIEHLPKYVMIATPSRTIVYTLVGKQLKATTATGWAYYVKSKAGDYSTEARTDNLSEHEK LLHMV
Uniprot No.

Target Background

Function
A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.
Database Links

KEGG: vg:10040185

Protein Families
Alphacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of the Feline Coronavirus Membrane (M) protein?

The M protein is a type III glycoprotein that serves as the most abundant structural component of the FCoV virion. It consists of a short amino-terminal ectodomain, a triple-spanning transmembrane domain, and a carboxyl-terminal inner domain . Functionally, the M protein plays a crucial role in viral envelope assembly through interactions with other structural proteins. Studies have shown that while the M protein alone cannot assemble viral particles, its presence is essential for virion formation when co-expressed with other viral components .

How does the FCoV M protein contribute to viral assembly and particle formation?

The M protein plays a central role in coronavirus envelope assembly through specific interactions with other viral structural proteins. Experimental evidence demonstrates that when the M protein is co-expressed with the small membrane protein (E), these two proteins alone are sufficient to drive the formation of virus-like particles (VLPs) . This process occurs through the following mechanism:

  • The M protein alone is unable to induce membrane curvature or particle budding

  • When co-expressed with the E protein, the M protein facilitates the formation of curvature in cellular membranes

  • This interaction eventually leads to the budding of vesicles with typical virion size

  • If the spike (S) protein is present during this process, it becomes incorporated into these particles through direct interactions with the M protein

As documented in experimental studies: "When we coexpressed all three membrane proteins, we encountered particles in the medium, which were morphologically indistinguishable from coronavirions... with only the M and E envelope proteins particles were still formed, while nothing happened when the proteins were expressed separately" . This finding demonstrates that while the S protein is dispensable for particle formation, the M and E proteins are essential components of the coronavirus assembly machinery.

What genomic features characterize the M gene in different FCoV strains?

The M gene is relatively conserved among FCoV strains compared to other viral genes such as the spike (S) gene. Analysis of whole genome sequences from Thai-FCoV strains showed that while significant genetic variation exists in the ORF1ab and S gene regions, the M gene displays greater conservation .

The M gene typically encodes a protein of approximately 230 amino acids. Phylogenetic analysis of FCoV sequences indicates that the M gene can be used as a marker for distinguishing between viral lineages, though it shows less variability than the S gene which is often used to differentiate between serotypes and pathotypes .

Recombination events involving the M gene occur less frequently than those involving the S gene or ORF1ab regions. In a study of Thai-FCoV isolates, recombination analysis revealed that "the recombination event was found at the ORF1ab gene with significant..." findings, whereas the M gene showed higher genetic stability .

What expression systems are most effective for producing recombinant FCoV M protein?

Several expression systems have been successfully employed for producing recombinant FCoV M protein, each with distinct advantages depending on research objectives:

Bacterial Expression Systems:

  • E. coli strain BL-21 with GST fusion vectors (pGEX4T-1) has proven effective for producing recombinant nucleocapsid proteins and can be adapted for M protein expression

  • Purification typically involves affinity chromatography on glutathione-Sepharose 4B

Viral Vector Expression Systems:

  • Modified vaccinia virus Ankara (MVA) has been used as an expression vector for FIPV M protein under control of a strong early/late promoter (H5R gene of vaccinia virus)

  • This approach allows for expression in mammalian cells with proper post-translational modifications

Yeast-Based Systems:

  • Transformation-associated recombination (TAR) in yeast has been employed for assembling complete FCoV genomes, which can include modified M gene sequences

  • The TAR system allows for rapid rescue of different FCoV strains with defined genetic modifications

Selection of an appropriate expression system depends on experimental goals, with bacterial systems offering high yield but lacking mammalian post-translational modifications, while viral vector systems provide more authentic protein structure but with potentially lower yields.

How can researchers verify the identity and integrity of recombinant FCoV M protein?

Verification of recombinant FCoV M protein identity and integrity requires multiple complementary approaches:

Western Blotting Analysis:

  • Using M protein-specific monoclonal antibodies (e.g., MAb F19-1)

  • Protocol: Separate proteins via 12% SDS-PAGE, transfer to nitrocellulose or PVDF membrane, block with 5% non-fat milk in TBST, incubate with primary antibody (e.g., MAb F19-1), followed by HRP-conjugated secondary antibody detection

Mass Spectrometry Verification:

  • Peptide mass fingerprinting to confirm amino acid sequence

  • Site-specific glycosylation analysis, especially important since proper glycosylation affects protein folding and function

Functional Assays:

  • Co-expression with other viral components (E protein) to assess VLP formation

  • Immunofluorescence assays in mammalian cells to verify cellular localization patterns

Electron Microscopy:

  • Negative staining or cryo-EM to visualize potential particle formation when co-expressed with other viral proteins

A comprehensive verification workflow should include at least protein-level confirmation (Western blot/MS) and a functional assessment to ensure biological activity of the recombinant protein.

What purification strategies yield the highest purity and functional integrity of recombinant FCoV M protein?

Purification of recombinant FCoV M protein presents challenges due to its hydrophobic transmembrane domains. Successful strategies include:

For GST-Tagged Fusion Proteins:

  • Affinity chromatography using glutathione-Sepharose 4B columns

  • Optional tag removal using site-specific proteases (e.g., thrombin)

  • Further purification by ion exchange or size exclusion chromatography

For His-Tagged Constructs:

  • Metal affinity chromatography using Ni-NTA or similar matrices

  • Optimization of detergent conditions for membrane protein solubilization

  • Gradual detergent removal using dialysis or cyclodextrin-based approaches

For Viral Vector-Expressed Proteins:

  • Cell lysis using appropriate detergent mixtures (e.g., DOTAP)

  • Clarification by freeze-thawing and sonication

  • Density gradient ultracentrifugation for VLP separation

Key considerations include maintaining the native conformation of membrane-spanning regions and preserving proper protein-protein interaction interfaces. Detergent selection and concentration are critical parameters that require optimization for each specific construct and expression system.

How can recombinant FCoV M protein be used to study viral assembly mechanisms?

Recombinant FCoV M protein provides a powerful tool for dissecting the molecular mechanisms of coronavirus assembly through several experimental approaches:

Co-expression Systems for VLP Formation:

  • Expression of M protein with various combinations of other viral proteins (E, S, N) in mammalian cells

  • Quantification of VLP production efficiency under different conditions

  • Systematic mutation of M protein domains to identify regions essential for assembly

An elegant experimental paradigm demonstrated that "when we coexpressed all three membrane proteins, we encountered particles in the medium, which were morphologically indistinguishable from coronavirions... with only the M and E envelope proteins particles were still formed, while nothing happened when the proteins were expressed separately" .

Reverse Genetics Applications:

  • Engineering of recombinant FCoVs with modified M proteins allows assessment of assembly phenotypes in the context of complete viral replication

  • Systems like the "targeted RNA recombination" approach enable precise genetic manipulation of the M gene in infectious FCoV clones

Protein-Protein Interaction Mapping:

  • Co-immunoprecipitation studies to identify M protein interaction partners

  • Analysis of oligomerization properties and structural determinants of protein complex formation

These approaches collectively enable researchers to establish structure-function relationships for the M protein and identify potential targets for antiviral intervention strategies.

What role does the M protein play in FCoV pathogenesis and host immune responses?

The role of FCoV M protein in viral pathogenesis and host immunity involves several key aspects:

Contributions to Viral Pathotype Switching:

  • While mutations in the spike (S) protein (e.g., M1058L substitution) are most strongly associated with the switch from enteric tropism to the systemic FIP phenotype, the M protein may also influence cell tropism and virulence

  • Research shows that "efficient FCoV replication in activated monocytes and macrophages is a key event in FIP pathogenesis" , a process potentially influenced by M protein functions

Immunological Properties:

  • M protein-specific antibodies develop during natural infection and vaccination

  • Vaccination studies with recombinant MVA expressing M protein demonstrated that "all the vaccinated animals developed FIPV-specific IgG" after immunization

Table 1: Immunological Responses to M Protein Vaccination

Vaccination ScheduleIgG ResponseProtection Against ChallengeReference
Single MVA-M doseFIPV-specific IgG titers up to 1:1000No protection against FIPV challenge
Two MVA-M dosesBoosted FIPV-specific IgG titersNo protection against FIPV challenge

Despite inducing antibody responses, M protein-based vaccines have shown limited protection against FIPV challenge, suggesting that "there was no correlation between the serological status and the evolution of the disease" . This indicates that while M protein contributes to immunogenicity, it alone may be insufficient to confer protective immunity.

How do recombinant viruses expressing chimeric M proteins affect viral tropism and replication kinetics?

Studies employing recombinant FCoVs with chimeric or modified M proteins have provided insights into how this protein influences viral phenotypes:

Impact on Cell Tropism:

  • While the S protein is the primary determinant of cell tropism, the M protein may influence host cell infection through interactions with cellular factors

  • Recombinant FCoVs expressing chimeric S proteins have demonstrated altered cell tropism, particularly regarding the use of feline aminopeptidase N (fAPN) as a receptor

Effects on Viral Replication:

  • Experiments using reverse genetics systems have shown that modifications to viral proteins, including M, can alter growth characteristics

  • For example, "recombinant FCoVs expressing a type II FCoV S protein acquire the ability to efficiently use fAPN for host cell entry" and display "accelerated growth kinetics" compared to type I FCoVs

Experimental Evidence from Cellular Models:

  • Infection studies in CD14+ feline monocytes revealed that recombinant viruses with type II S proteins (recFCoV-GFP-SII) showed different infection patterns compared to type I recombinants (recFCoV-GFP)

  • The infection efficiency varied between monocytes from different donors, with only some showing productive infection with titers of "10^4 PFU/ml at 36 to 48 h p.i."

These findings highlight the complex interplay between viral proteins in determining coronavirus phenotypes and underscore the importance of studying these interactions in the context of complete viral particles rather than isolated proteins.

What are the prospects for using recombinant FCoV M protein in vaccine development?

Research on recombinant FCoV M protein as a vaccine candidate has yielded important insights with both promising aspects and significant challenges:

Historical Vaccine Approaches:

  • Previous studies indicated that poxvirus vectors (vaccinia WR and canarypox) expressing only the FIPV M protein could elicit partially protective immunity, presumed to be cell-mediated

  • Modified vaccinia virus Ankara (MVA) expressing the M protein under a strong early/late promoter has been tested as a vaccine vector

Immunization Results:

  • In cats vaccinated with MVA-M, "all the vaccinated animals developed FIPV-specific IgG" after a single inoculation

  • A second injection boosted antibody titers to levels up to 1:1000

Protection Outcomes:

  • Despite generating antibody responses, MVA-M vaccination failed to protect cats against FIPV challenge

  • "Every cat from each group presented FIP symptoms from the 2nd or the 3rd week post-infection, leading to death, or euthanasia, on weeks 5 and 6"

  • There was "no correlation between the serological status and the evolution of the disease"

These findings suggest that while M protein can induce humoral immunity, additional components or alternative approaches may be necessary to develop effective FIP vaccines. Future strategies might include combining M protein with other viral antigens or utilizing different adjuvants to promote more balanced immune responses with stronger cell-mediated components.

How can reverse genetics systems be optimized for studying M protein functions in FCoV?

Reverse genetics systems provide powerful tools for investigating M protein functions in the context of complete viral genomes. Several approaches have been developed:

Targeted RNA Recombination:

  • This two-step process involves creating an interspecies chimeric virus (mFIPV) with an MHV spike ectodomain, followed by reconstitution of the FIPV genome through recombination

  • The system allows "genetic engineering of the FIPV genome" including the M gene

  • This approach enabled the construction of a wild-type recombinant virus (r-wtFIPV) that was "indistinguishable from its parental virus FIPV 79-1146"

Transformation-Associated Recombination (TAR) in Yeast:

  • More recent systems utilize TAR in yeast for rapid rescue of different FCoV strains

  • The process involves designing overlapping FCoV fragments, co-transferring them with a TAR clone vector into yeast cells, assembling the whole virus genome, and extracting recombinant plasmids

  • Validation includes RT-PCR, immunofluorescence assays (IFA), Western blot analysis, and electron microscopy

Optimization Strategies:

  • Utilizing shuttle vectors for rapid transfer between bacterial and yeast systems

  • Implementing efficient selection markers for recombinant identification

  • Developing cell lines that support growth of recombinant viruses

  • Employing next-generation sequencing to verify sequence integrity

These systems can be specifically adapted for M protein studies by introducing targeted mutations, deletions, or substitutions in the M gene region to assess functional consequences during the complete viral lifecycle.

How do extracellular vesicles (EVs) interact with recombinant FCoV M protein, and what are the implications for viral pathogenesis?

Recent research has revealed interesting connections between FCoV infection, extracellular vesicles (EVs), and viral proteins including the M protein:

Effects of FCoV Infection on EV Characteristics:

  • FCoV infection alters EV production and composition in host cells

  • NanoSight particle tracking analysis showed that "the mean particle sizes of control EVs were 131.9 nm and 126.6 nm, while FCoV infected-derived EVs were 143.4 nm and 120.9 nm at 48 and 72 h, respectively"

  • Total protein content was "significantly increased at 48 h" in infection-derived EVs

Protein Expression Changes in EVs:

  • FCoV infection alters the expression of specific protein markers in EVs

  • Affected proteins include "TMPRSS2, ACE2, Alix, TSG101, CDs (29, 47, 63), TLRs (3, 6, 7), TNF-α, and others"

  • These alterations suggest EVs may play roles in infection progression and disease evolution

Methodological Approaches for Studying EV-M Protein Interactions:

  • EVs can be isolated from FCoV-infected cells using ultracentrifugation or commercial isolation kits

  • Western blot analysis using PVDF membranes allows detection of M protein and other viral components in EVs

  • Proteins are typically transferred "in a transfer chamber at 45 mA" overnight, followed by antibody detection

These findings suggest potential roles for EVs in FCoV pathogenesis, possibly including:

  • Transport of viral proteins (including M) between cells

  • Modulation of immune responses through altered protein cargo

  • Enhancement of viral dissemination through "Trojan horse" mechanisms

This emergent research area highlights how recombinant M proteins could be used to study intercellular communication during FCoV infection and potentially develop novel diagnostic or therapeutic approaches.

What are the most promising targets for mutagenesis studies of the FCoV M protein?

Based on current knowledge, several specific regions and features of the FCoV M protein warrant targeted mutagenesis studies:

Transmembrane Domains:

  • The triple-spanning transmembrane region is critical for membrane integration and viral assembly

  • Systematic alanine scanning or domain swapping between different coronavirus M proteins could identify specific residues essential for function

Cytoplasmic Domain:

  • The C-terminal cytoplasmic domain interacts with nucleocapsid (N) protein and likely influences virion assembly

  • Targeted mutations in this region could reveal interaction motifs and functional determinants

Protein-Protein Interaction Sites:

  • Residues involved in M-E and M-S interactions are critical for viral assembly

  • Identification and mutation of these sites could provide insights into assembly mechanisms and potential antiviral targets

N-Terminal Ectodomain:

  • This domain is exposed on the virion surface and may contribute to immune recognition

  • Mutations affecting glycosylation or surface epitopes could influence immunogenicity

Applying reverse genetics approaches with these targeted mutations would allow assessment of their effects on viral assembly, replication, and pathogenesis in both cell culture and animal models.

How might comparative studies between FCoV and SARS-CoV-2 M proteins inform therapeutic development?

Comparative studies between FCoV and SARS-CoV-2 M proteins offer valuable opportunities for therapeutic insights:

Structural and Functional Conservation:

  • Both FCoV and SARS-CoV-2 M proteins share fundamental structural features as triple-spanning membrane proteins

  • Research on FCoV protease inhibitors like GC376 has already informed SARS-CoV-2 drug development, as "the prodrug and its parent GC373, are effective inhibitors of the Mpro from both SARS-CoV and SARS-CoV-2 with IC50 values in the nanomolar range"

Differential Host Interactions:

  • Comparing how these M proteins interact with host cellular machinery could reveal conserved mechanisms

  • Identification of shared binding partners could suggest broad-spectrum therapeutic targets

Assembly Inhibition Strategies:

  • Since M proteins play essential roles in viral assembly across coronaviruses, compounds disrupting M protein function might have broad antiviral activity

  • The finding that M-E interactions drive membrane curvature and particle formation suggests a potential vulnerability

Table 2: Comparative Features of FCoV and SARS-CoV-2 M Proteins

FeatureFCoV M ProteinSARS-CoV-2 M ProteinTherapeutic Implication
StructureTriple-spanning membrane proteinTriple-spanning membrane proteinConserved structural targets
Assembly roleEssential, interacts with E proteinEssential for virion formationPotential for broad-spectrum assembly inhibitors
Host interactionsInteracts with feline cellular factorsInteracts with human cellular factorsSpecies-specific vs. conserved interaction targets
Drug sensitivitySome protease inhibitors effectiveSimilar protease inhibitors effectiveShared pharmacophore development

This comparative approach could accelerate therapeutic development by identifying conserved vulnerabilities across coronavirus species.

What methodological advances are needed to better study the structural biology of recombinant FCoV M protein?

Despite significant progress in coronavirus structural biology, several methodological challenges remain for the FCoV M protein:

Membrane Protein Structural Determination:

  • As a multi-pass membrane protein, the M protein presents challenges for traditional structural biology techniques

  • While cryo-EM has been successful for the FCoV S protein at 3.3-Å resolution , similar studies of the M protein are lacking

  • Advanced detergent screening, nanodiscs, or amphipol approaches could stabilize the M protein for structural studies

In Situ Structural Analysis:

  • Techniques like cryo-electron tomography could visualize M protein within intact virions

  • This would provide insights into native interactions and organization

Integrative Structural Biology:

  • Combining multiple techniques (X-ray crystallography of soluble domains, NMR of transmembrane peptides, cryo-EM of full-length protein, and computational modeling)

  • Such approaches have been successful for the FCoV S protein where "the near-atomic EM map enabled ab initio modeling of 27 out of the 33 experimentally verified high-mannose and complex-type N-glycans"

Mass Spectrometry Innovations:

  • Native mass spectrometry of membrane protein complexes could reveal oligomerization states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) could map dynamic regions and interaction interfaces

  • Techniques used for S protein glycosylation analysis could be adapted for M protein studies

Advances in these methodologies would significantly enhance our understanding of FCoV M protein structure-function relationships and facilitate rational design of therapeutics targeting coronavirus assembly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.