Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biochemical Context

cobS is part of a multi-gene cluster involved in cobinamide salvage, which allows bacteria to convert exogenous cobinamide into functional vitamin B₁₂. This pathway is distinct from de novo corrinoid synthesis and is critical for thermophilic organisms in cobalamin-scarce environments .

Key Functions of cobS

  • Precursor Modification: Converts cobinamide into adenosylcobinamide (AdoCbi) via adenosylation.

  • Integration with Salvage Pathway: Works in tandem with other enzymes (e.g., cobT, cobU, cobD) to reconstruct the lower ligand and nucleotide moiety of B₁₂ .

Genomic and Evolutionary Insights

The cobS gene is part of a conserved gene cluster in F. nodosum and other Thermotogales, including Thermotoga lettingae and Thermosipho africanus. This cluster includes:

GeneFunctionExpression Regulation (Tt. lettingae)
cobT’Cobinamide salvage enzyme↑ 11.6-fold without B₁₂/cobinamide
cobSAdenosylcobinamide synthase↑ 2.9-fold with cobinamide
cbiBATP-dependent ligase for lower ligand attachment↑ 7.0-fold without B₁₂/cobinamide
cobAPhosphorylation of adenosylcobinamide↑ 5.3-fold without B₁₂/cobinamide

In Tt. lettingae, transcription of cobS and related genes is regulated by a B₁₂-responsive riboswitch, ensuring pathway activation only under cobinamide/B₁₂ scarcity .

Expression and Regulation

In Tt. lettingae, cobS expression is highly inducible:

Growth ConditioncobS Expression (Relative Fold)
No B₁₂ or cobinamide1.0 ± 0.2
With cobinamide2.9 ± 1.1

This upregulation highlights cobS’s role in cobinamide salvage. While F. nodosum’s cobS has not been directly studied, its genomic conservation suggests similar regulatory mechanisms .

Research Gaps and Future Directions

Direct studies on recombinant F. nodosum cobS are absent in the literature. Prioritizing areas for research:

  1. Heterologous Expression: Cloning and purification of cobS in mesophilic hosts to study catalytic activity.

  2. Enzyme Kinetics: Determining substrate affinity (Kₘ) and turnover rates for cobinamide and adenosylcobinamide.

  3. Structural Biology: X-ray crystallography to resolve active-site interactions with corrinoid precursors.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
cobS; Fnod_1368; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Target Names
cobS
Target Protein Sequence
MQDSLKDILLTFSFISRLPVKLGELSDWEVRMKRIPAYFTIVGYIPGLIYFTGSFLSLNF GIIAPLLSIVLGFYLFDLFHFDGLLDTLDGFLNQSSKSRRLEIMSKGNVGPFAVFYGVLY VIVFWELITSIEPVAFVFGSVFGRYTMDVVLVFSKPAKNEGLGAMLFPFNRFLLVPATLF TLPLLLIDVKLFLVSIFSSWLVGFLISKVSEKQIGGVTGDVLGGSCLIGQIVVLLILNYL I
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does CobS function in the cobalamin biosynthetic pathway?

In the cobalamin biosynthetic pathway, CobS functions at a late stage in the assembly of the nucleotide loop. Based on research with S. typhimurium, which provides a model for understanding CobS function across species, the enzyme catalyzes the crucial step of joining the nucleotide (α-ribazole-5′-phosphate) to adenosylcobinamide-GDP . This reaction creates adenosylcobalamin-5′-phosphate, which is subsequently dephosphorylated by CobC to form adenosylcobalamin (the active form of vitamin B12).

The pathway operates as follows:

  • CobU converts adenosylcobinamide to adenosylcobinamide-GDP

  • CobT synthesizes α-ribazole-5′-phosphate from 5,6-dimethylbenzimidazole and nicotinate mononucleotide

  • CobS joins adenosylcobinamide-GDP and α-ribazole-5′-phosphate to form adenosylcobalamin-5′-phosphate

  • CobC dephosphorylates the product to yield adenosylcobalamin

This sequential enzymatic process highlights the essential role of CobS in completing the functional structure of cobalamin .

What expression systems are suitable for producing recombinant F. nodosum CobS?

For recombinant production of F. nodosum CobS, several expression systems can be employed, with E. coli being the most common due to its simplicity and high yield. The recombinant protein is typically produced with affinity tags to facilitate purification, with histidine tags (His-tags) being particularly useful for metal affinity chromatography .

When designing an expression system, researchers should consider:

  • Codon optimization for the host organism

  • Selection of appropriate promoters for controlled expression

  • Addition of affinity tags that don't interfere with protein folding or activity

  • Growth conditions optimized for thermophilic protein expression (F. nodosum is a thermophile)

  • Use of chaperones if needed to assist proper protein folding

Storage of the purified protein is recommended in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended periods, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles that could compromise enzyme activity .

How can researchers measure and verify CobS enzymatic activity in vitro?

Measuring CobS enzymatic activity requires a carefully designed assay system that can detect the conversion of substrates to products. Based on methodologies developed for S. typhimurium CobS, the following approach can be adapted for F. nodosum CobS:

Enzymatic Activity Assay Protocol:

  • Prepare reaction mixtures containing:

    • Adenosylcobinamide-GDP (substrate)

    • α-ribazole-5′-phosphate (substrate)

    • Purified CobS enzyme

    • Appropriate buffer systems maintaining optimal pH and salt concentration

    • Necessary cofactors (if required)

  • Incubate reactions at the optimal temperature for F. nodosum enzyme activity (likely higher than mesophilic enzymes due to the thermophilic nature of the organism)

  • Analyze reaction products using:

    • Reverse-phase HPLC (RP-HPLC) for separation and quantification

    • UV-visible spectroscopy for identification (cobamides have characteristic absorption spectra)

    • Mass spectrometry for confirmation of molecular identity

  • Quantify activity using radiolabeled substrates, reporting specific activity in nmol of product per min per mg of protein

  • Verify biological activity of the produced cobalamin-5′-phosphate by testing its ability to support growth of cobalamin auxotrophs in complementation assays

The specific activity of recombinant CobS can be compared to crude cell extracts, with properly folded and active enzymes typically showing activities in the range of 8-22 nmol product/min/mg protein, as observed with S. typhimurium homologs .

What are the kinetic parameters of F. nodosum CobS and how do they compare to CobS from mesophilic organisms?

While specific kinetic data for F. nodosum CobS is limited in the current literature, researchers investigating this enzyme should determine the following parameters and compare them to mesophilic homologs:

Key Kinetic Parameters to Determine:

ParameterDescriptionExpected Differences in F. nodosum
Km for adenosylcobinamide-GDPSubstrate concentration at half-maximal activityPotentially higher due to thermophilic adaptation
Km for α-ribazole-5′-phosphateSubstrate concentration at half-maximal activityMay differ based on structural adaptations
kcatTurnover number (catalytic rate constant)Typically higher in thermophilic enzymes
kcat/KmCatalytic efficiencyMay show temperature-dependent optimization
Temperature optimumTemperature of maximal activitySignificantly higher than mesophilic homologs
pH optimumpH of maximal activityMay differ based on cellular environment
Thermal stability (T1/2)Temperature at which 50% activity remainsSubstantially higher for thermophilic enzyme

When comparing F. nodosum CobS to mesophilic homologs like those from S. typhimurium, researchers should consider that thermophilic enzymes typically demonstrate:

  • Enhanced structural rigidity

  • Higher temperature optima

  • Greater resistance to denaturation

  • Potentially different substrate affinities optimized for their native environment

These comparisons provide valuable insights into structure-function relationships and enzymatic adaptations to extreme environments .

How do structural variations in CobS affect substrate specificity across different species?

The structural variations in CobS across species likely influence substrate specificity and catalytic efficiency. Research approaches to investigate this question should include:

  • Comparative Sequence Analysis:

    • Align CobS sequences from F. nodosum, S. typhimurium, and other organisms

    • Identify conserved catalytic residues versus variable regions

    • Map variations to functional domains

  • Homology Modeling and Structural Analysis:

    • Generate structural models of F. nodosum CobS based on crystallized homologs

    • Identify substrate binding pockets and catalytic sites

    • Compare structural features that may impact specificity

  • Site-Directed Mutagenesis Studies:

    • Create targeted mutations in residues suspected to influence specificity

    • Evaluate how these mutations affect activity with different substrates

    • Determine if F. nodosum-specific residues confer unique properties

  • Substrate Range Testing:

    • Examine activity with various substrate analogs

    • Test whether F. nodosum CobS can utilize alternative lower ligand bases in place of 5,6-dimethylbenzimidazole

    • Assess whether thermophilic adaptation influences substrate range

Research with S. typhimurium CobS has demonstrated that the enzyme can catalyze the formation of various cobamides with structurally different lower-ligand bases, suggesting a degree of substrate flexibility that may also be present in F. nodosum CobS . This flexibility offers opportunities for the synthesis of novel cobalamin derivatives with potential research applications.

What are the optimal conditions for expressing and purifying recombinant F. nodosum CobS?

Based on the thermophilic origin of F. nodosum, specialized conditions are required for optimal expression and purification of its recombinant CobS enzyme:

Optimized Expression Protocol:

  • Vector Selection and Construct Design:

    • Use expression vectors with strong, inducible promoters (T7, tac)

    • Include affinity tags (preferably His-tag) for purification

    • Consider fusion partners that enhance solubility if inclusion body formation is observed

  • Host Selection:

    • E. coli BL21(DE3) or Rosetta strains for addressing rare codon usage

    • Consider specialized hosts for thermophilic protein expression if standard hosts yield poor results

  • Culture Conditions:

    • Initial growth at 37°C to optimal density (OD600 ~0.6-0.8)

    • Induction with IPTG (0.1-1.0 mM)

    • Post-induction growth at lower temperatures (16-30°C) to enhance protein folding

    • Extended expression times (overnight) at reduced temperatures

  • Purification Strategy:

    • Cell lysis in Tris-based buffer with protease inhibitors

    • Heat treatment step (potential advantage for thermophilic proteins)

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography for final polishing

    • Storage in Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Quality Control:

    • SDS-PAGE to verify purity

    • Western blot with anti-His antibodies or specific anti-CobS antibodies

    • Mass spectrometry to confirm protein identity

    • Activity assays to confirm functional state

This methodological approach can be further optimized based on specific laboratory conditions and equipment availability.

How can researchers investigate the interaction between CobS and other enzymes in the cobalamin biosynthetic pathway?

Investigating protein-protein interactions in multi-enzyme pathways requires sophisticated methodological approaches:

Methodological Approaches for Studying Enzyme Interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against CobS to pull down potential interaction partners

    • Identify co-precipitated proteins by mass spectrometry

    • Verify interactions with reciprocal Co-IP using antibodies against suspected partners

  • Bacterial Two-Hybrid System:

    • Create fusion constructs of CobS and potential partners with split reporter domains

    • Measure reporter activity as indication of protein interaction

    • Screen for interactions with CobU, CobT, and CobC proteins

  • Surface Plasmon Resonance (SPR) or Biolayer Interferometry (BLI):

    • Immobilize purified CobS on sensor chips or biosensors

    • Measure binding kinetics with other purified pathway enzymes

    • Determine association and dissociation constants

  • In vitro Reconstitution Assays:

    • Combine purified CobS with other pathway enzymes (CobU, CobT, CobC)

    • Measure complete pathway activity with all components present

    • Systematically omit individual components to assess dependencies

    • Based on S. typhimurium studies, complete pathway reconstitution should convert adenosylcobinamide to adenosylcobalamin when all four enzymes are present

  • Analytical Ultracentrifugation or Size Exclusion Chromatography:

    • Detect complex formation between CobS and other enzymes

    • Determine stoichiometry of potential multi-enzyme complexes

Research with S. typhimurium has shown that CobU, CobS, CobT, and CobC work together in the nucleotide loop assembly pathway, with specific sequential activities, suggesting potential for transient protein-protein interactions or substrate channeling that may also exist in the F. nodosum system .

What methods can be used to analyze the thermal stability and adaptation of F. nodosum CobS?

F. nodosum is a thermophilic organism, and its CobS enzyme is likely to exhibit thermal adaptations that can be analyzed using the following methodological approaches:

Thermal Stability Analysis Methods:

  • Differential Scanning Calorimetry (DSC):

    • Directly measures protein unfolding transitions

    • Determines melting temperature (Tm) and enthalpy of unfolding

    • Compare with mesophilic homologs to quantify thermostability differences

  • Circular Dichroism (CD) Spectroscopy:

    • Monitors secondary structure changes during thermal denaturation

    • Generates thermal unfolding curves

    • Identifies intermediate states during unfolding process

  • Thermal Shift Assays (Thermofluor):

    • Utilizes environmentally sensitive fluorescent dyes

    • Monitors protein unfolding via fluorescence changes

    • High-throughput method for screening stabilizing conditions

  • Activity Assays at Varying Temperatures:

    • Measure enzymatic activity across temperature range (30-100°C)

    • Determine temperature optimum and activation energy

    • Assess residual activity after exposure to elevated temperatures

  • Molecular Dynamics Simulations:

    • In silico analysis of protein stability and dynamics

    • Identify key stabilizing interactions and rigid regions

    • Compare with mesophilic homologs to identify thermostabilizing features

Expected Thermal Adaptation Features:

  • Increased number of salt bridges and hydrogen bonds

  • Enhanced hydrophobic core packing

  • Reduced number of thermolabile residues (Asn, Gln)

  • Higher proline content in loop regions

  • Shorter surface loops

Understanding these thermal adaptations provides insights into enzyme evolution and potential applications in protein engineering for enhanced stability .

How can recombinant F. nodosum CobS be used for in vitro synthesis of novel cobalamin derivatives?

The enzymatic flexibility of CobS offers opportunities for synthesizing novel cobalamin derivatives with potential research and therapeutic applications:

Methodological Approach for Novel Cobalamin Synthesis:

  • Substrate Analog Preparation:

    • Synthesize or obtain modified versions of α-ribazole-5′-phosphate with alternative lower ligand bases

    • Prepare adenosylcobinamide-GDP using recombinant CobU or chemical synthesis

  • In vitro Enzymatic Synthesis:

    • Combine purified recombinant F. nodosum CobS with substrate analogs

    • Optimize reaction conditions for thermophilic enzyme (temperature, pH, buffer composition)

    • Monitor reaction progress by HPLC or spectroscopic methods

  • Product Purification and Characterization:

    • Isolate novel cobamides using RP-HPLC

    • Confirm structure by UV-visible spectroscopy and mass spectrometry

    • Analyze structure-function relationships with NMR if necessary

  • Functional Assessment:

    • Test biological activity of novel cobamides in cobalamin-dependent enzymatic reactions

    • Evaluate binding to cobalamin-dependent enzymes and transport proteins

    • Assess potential therapeutic properties for cobalamin-related disorders

Research with S. typhimurium CobS has demonstrated that the enzyme can utilize various lower ligand bases to create different cobamides, suggesting that F. nododum CobS may offer similar synthetic flexibility, potentially enhanced by its thermostability . This capability presents a unique in vitro system for the synthesis of novel cobalamin derivatives under controlled conditions.

What are the structural determinants of thermostability in F. nodosum CobS compared to mesophilic homologs?

Understanding the structural basis for thermostability in F. nodosum CobS requires comparative analysis with mesophilic homologs:

Research Methodology for Thermostability Analysis:

  • Comparative Sequence Analysis:

    • Align sequences of CobS from thermophilic (F. nodosum) and mesophilic organisms

    • Calculate amino acid composition differences

    • Identify thermostability-associated substitution patterns

  • Structural Comparison:

    • Generate homology models or determine crystal structures

    • Compare secondary structure elements and their distribution

    • Analyze surface charge distribution and electrostatic networks

  • Targeted Mutagenesis Experiments:

    • Create chimeric proteins with domain swapping between thermophilic and mesophilic CobS

    • Introduce thermophilic-specific residues into mesophilic CobS

    • Measure resulting changes in thermal stability

  • Computational Analysis:

    • Calculate energy contributions of different interactions

    • Perform molecular dynamics simulations at elevated temperatures

    • Identify rigid clusters and flexible regions

Expected Thermostabilizing Features:

FeatureTypical in Thermophilic ProteinsMethod of Detection
Electrostatic interactionsIncreased number of salt bridgesStructure analysis
Hydrophobic coreEnhanced packing densityComputational analysis
Surface loopsShorter, more rigidSequence and structure comparison
Proline contentHigher in loopsSequence analysis
Glycine contentLower (reduces flexibility)Sequence analysis
Disulfide bondsStrategic positioningStructure analysis
Secondary structureHigher α-helix and β-sheet contentCD spectroscopy and structure analysis

Identifying these structural determinants provides insights for protein engineering and the development of thermostable enzymes for biotechnological applications .

How does the catalytic mechanism of CobS differ between thermophilic and mesophilic organisms?

Investigating differences in catalytic mechanisms requires a combination of experimental and computational approaches:

Methodological Approaches for Catalytic Mechanism Studies:

  • Steady-State Kinetics:

    • Determine kinetic parameters (Km, kcat) at various temperatures

    • Calculate activation energies using Arrhenius plots

    • Compare temperature dependence between thermophilic and mesophilic enzymes

  • Pre-Steady-State Kinetics:

    • Use stopped-flow techniques to identify rate-limiting steps

    • Measure individual steps in the reaction mechanism

    • Identify differences in reaction intermediates

  • pH-Dependency Studies:

    • Determine pH-activity profiles for both enzyme types

    • Identify catalytic residues based on pKa values

    • Compare optimal pH ranges for activity

  • Isotope Effects:

    • Utilize substrates with isotopic labeling

    • Measure primary and secondary isotope effects

    • Determine transition state structures

  • Site-Directed Mutagenesis:

    • Target predicted catalytic residues

    • Compare effects of mutations in both enzyme types

    • Identify residues with differing roles in catalysis

  • Computational Approaches:

    • Perform quantum mechanical/molecular mechanical (QM/MM) simulations

    • Calculate energy barriers for reaction steps

    • Compare transition state structures

Research on S. typhimurium CobS has provided insights into the general catalytic mechanism of cobalamin synthase, involving the joining of adenosylcobinamide-GDP and α-ribazole-5′-phosphate, but detailed mechanistic comparisons with thermophilic variants remain an area for future investigation . Understanding these differences can reveal fundamental principles of enzyme adaptation to extreme environments.

What are the most promising research directions for F. nodosum CobS?

Research on F. nodosum Cobalamin synthase offers several promising directions for future investigation:

  • Structural Biology:

    • Determination of high-resolution crystal or cryo-EM structures

    • Elucidation of substrate binding modes and catalytic mechanisms

    • Comparative analysis with mesophilic homologs

  • Enzyme Engineering:

    • Development of hyperthermostable variants for industrial applications

    • Creation of enzymes with modified substrate specificity

    • Engineering of efficient biocatalysts for cobalamin derivative synthesis

  • Synthetic Biology:

    • Integration into artificial pathways for cobalamin production

    • Development of cell-free systems for vitamin B12 synthesis

    • Creation of engineered microorganisms with enhanced B12 production

  • Comparative Biochemistry:

    • Systematic comparison of CobS enzymes across thermophilic, mesophilic, and psychrophilic organisms

    • Evolution of cobalamin biosynthesis pathways in extremophiles

    • Adaptation mechanisms of enzymatic function to extreme environments

These research directions leverage the unique properties of F. nodosum CobS to address fundamental questions in biochemistry and develop potential biotechnological applications. The thermostable nature of this enzyme makes it particularly valuable for industrial processes requiring elevated temperatures or enhanced stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.