Recombinant Fervidobacterium nodosum Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Biosynthesis

Lgt catalyzes the first step in lipoprotein maturation, enabling downstream processing by signal peptidase II (Lsp) and apolipoprotein N-acyltransferase (Lnt) . Key findings:

  • Essentiality: Lgt is indispensable for bacterial viability in E. coli and Listeria monocytogenes . Depletion leads to cell envelope defects and lethality .

  • Substrate specificity: Recognizes the lipobox motif ([LVI][ASTVI][GAS]C) .

  • Thermotoga applications: Horizontal gene transfer (LGT) studies in Fervidobacterium highlight Lgt’s role in lipoprotein-mediated virulence and antibiotic resistance .

Biotechnological and Therapeutic Applications

Recombinant Lgt serves as a tool for:

  • Antibiotic development: Inhibitors targeting Lgt’s active site (e.g., palmitic acid analogs) disrupt lipoprotein anchoring, offering broad-spectrum potential .

  • Protein engineering: Studying lipid modification pathways in extremophiles like F. nodosum, which thrive in hydrocarbon-rich environments .

  • CRISPR-based studies: Investigating LGT mechanisms between Thermotogota and Firmicutes facilitated by viral vectors .

Research Limitations and Future Directions

  • Partial functionality: The recombinant F. nodosum Lgt is expressed as a truncated protein , limiting full mechanistic studies.

  • Structural gaps: No high-resolution structure of F. nodosum Lgt exists; current models rely on E. coli homologs .

  • Thermostability: Engineered variants could enhance industrial utility in lipid-modified enzyme production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; Fnod_0909; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Target Names
lgt
Target Protein Sequence
MSKSKRIILSVVIILAVGIGLFFFLREVFSGRLIVRDYIFQIGKFQLRWYSICIASGILV AYVLARRRLSMYPIKPEDLDEGLFWGIVAGILGARIYYVIFNWNYYSKYPSEIYKIWHGG LAIHGGIFGALLMIFIYSKIKGYFKFVHATDLFTSVLPLAQAIGRWGNFFNYEAYGRPTT LPWKMYVPPERRMPGFDIDRFFHPTFLYESLWDITIFVFLYFFVEKRKREYGETTALYLI LYSLGRFWIESLRLDSLMAGHFRAAQVVSIILIFIGAAWYAYIIGKTGKRDN
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) from *Fervidobacterium nodosum* catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the first step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of Lgt in bacterial lipoprotein biosynthesis?

Lgt (prolipoprotein diacylglyceryl transferase) catalyzes the first step in bacterial lipoprotein maturation. Following synthesis, preprolipoproteins are transported through the cytoplasmic membrane via the Sec or Tat translocon. As they exit the transport machinery, Lgt recognizes these proteins and converts them to prolipoproteins by adding a diacylglyceryl group to the sulfhydryl side chain of the invariant Cys+1 residue . This lipid modification anchors lipoproteins to cell membranes, which is essential for various cellular functions including envelope integrity, nutrient acquisition, and protein secretion. The lgt gene is conserved across bacterial species, indicating its fundamental importance in bacterial physiology .

How does Fervidobacterium nodosum Lgt differ from mesophilic bacterial Lgt proteins?

F. nodosum Lgt, derived from a thermophilic bacterium with optimal growth temperature around 70°C, exhibits enhanced thermostability compared to mesophilic counterparts like those from E. coli or V. cholerae . This thermostability likely results from structural adaptations including increased hydrophobic interactions, more salt bridges, and a more compact folding. When designing expression systems for F. nodosum Lgt, researchers should consider these thermophilic properties, particularly when determining optimal buffer conditions, purification temperatures, and stability parameters. The thermostable nature of F. nodosum Lgt makes it particularly valuable for applications requiring enzyme functionality at elevated temperatures.

Is Lgt essential in Fervidobacterium nodosum as it is in Gram-negative bacteria?

Based on observations in other bacterial systems, Lgt is likely essential in F. nodosum, particularly if it follows the pattern seen in Gram-negative bacteria like E. coli where lgt mutations are lethal . In contrast, some Gram-positive bacteria like Corynebacterium glutamicum can survive without Lgt, though with altered growth characteristics . When designing genetic manipulation experiments with F. nodosum lgt, researchers should consider this potential essentiality. Complementation strategies similar to those used in E. coli (where V. cholerae lgt was provided in trans on a temperature-sensitive plasmid) might be necessary if attempting to manipulate the native lgt gene .

What expression systems are most effective for recombinant F. nodosum Lgt production?

For recombinant expression of F. nodosum Lgt, E. coli-based systems can be used with specific modifications to account for the thermophilic origin of the protein. Based on successful approaches with other Lgt proteins, a recommended expression system would involve:

  • Host strain: E. coli BL21(DE3) or derivatives that lack endogenous proteases

  • Vector: pET-based vectors with T7 promoter for high-level expression

  • Temperature: Initial growth at 37°C followed by induction at lower temperatures (16-30°C) to facilitate proper folding

  • Induction: IPTG concentrations of 0.1-0.5 mM for controlled expression

When designing the expression construct, consider incorporating:

  • An N-terminal His-tag for purification (C-terminal tags may interfere with function)

  • A TEV protease cleavage site if tag removal is necessary

  • Codon optimization for E. coli if expression levels are low

What purification strategy yields the highest purity and activity for recombinant F. nodosum Lgt?

A multi-step purification protocol is recommended for obtaining high-purity F. nodosum Lgt:

  • Membrane Preparation: Since Lgt is a membrane protein, begin with cell lysis followed by ultracentrifugation to isolate membrane fractions.

  • Detergent Solubilization: Solubilize membranes using mild detergents such as DDM (n-dodecyl-β-D-maltopyranoside) or LDAO (lauryldimethylamine oxide) at 1-2% concentration.

  • IMAC Purification: For His-tagged proteins, use Ni-NTA chromatography with imidazole gradient elution (20-300 mM).

  • Size Exclusion Chromatography: As a polishing step, perform gel filtration to remove aggregates and ensure homogeneity.

Throughout purification, maintain detergent concentrations above the critical micelle concentration in all buffers. For F. nodosum Lgt specifically, consider working at elevated temperatures (40-50°C) during select purification steps to leverage its thermostability and potentially eliminate heat-labile contaminants .

How can I assess the enzymatic activity of purified recombinant F. nodosum Lgt?

Enzymatic activity of purified F. nodosum Lgt can be assessed using a radiometric assay measuring the transfer of [³H]- or [¹⁴C]-labeled glycerol from phosphatidylglycerol to a synthetic preprolipoprotein substrate. The protocol involves:

  • Reaction Mixture Preparation:

    • Purified F. nodosum Lgt (5-20 μg)

    • Synthetic preprolipoprotein substrate (containing the lipobox motif)

    • [³H]-labeled phosphatidylglycerol (donor substrate)

    • Buffer system (typically phosphate buffer, pH 7.0-8.0)

    • Detergent at concentrations above CMC

  • Incubation: At 60-70°C (optimal for thermophilic enzymes) for 30-60 minutes

  • Reaction Termination: Using chloroform/methanol (2:1) extraction

  • Analysis: Quantify incorporated radioactivity in the organic phase by scintillation counting

An alternative non-radioactive approach uses mass spectrometry to detect the mass shift in the substrate peptide following diacylglyceryl addition. This approach allows for both qualitative confirmation of activity and quantitative assessment of reaction kinetics .

What are the critical structural features of F. nodosum Lgt that contribute to its thermostability?

F. nodosum Lgt likely employs several structural adaptations that contribute to its thermostability:

  • Increased Hydrophobic Interactions: Enhanced core packing through additional hydrophobic interactions stabilizes the protein at elevated temperatures.

  • Electrostatic Networks: Increased number of salt bridges and ionic interactions, particularly on the protein surface.

  • Reduced Flexibility: Fewer glycine residues and more proline residues in loop regions, reducing conformational flexibility.

  • Disulfide Bonds: Potentially additional disulfide bonds that stabilize tertiary structure at high temperatures.

  • Helix Stabilization: Higher alanine content in alpha-helical regions enhancing secondary structure stability.

To experimentally validate these features, researchers should consider employing circular dichroism spectroscopy to compare thermal unfolding profiles of F. nodosum Lgt with mesophilic counterparts, and differential scanning calorimetry to determine melting temperatures and thermodynamic parameters of unfolding .

How does substrate specificity of F. nodosum Lgt compare to Lgt from mesophilic organisms?

The substrate specificity of F. nodosum Lgt likely centers around recognition of the conserved lipobox motif ([LVI][ASTVI][GAS][C]) found in bacterial preprolipoprotein signal peptides. When comparing substrate specificity:

  • Signal Sequence Recognition: F. nodosum Lgt may recognize a more restricted range of signal sequences optimized for thermophilic environments.

  • Lipid Substrate Preference: The enzyme likely prefers more saturated phospholipids as acyl donors, reflecting the membrane composition of thermophiles.

  • Temperature-Dependent Kinetics: Unlike mesophilic Lgt enzymes, F. nodosum Lgt will exhibit optimal activity at elevated temperatures (60-70°C).

To experimentally determine substrate specificity differences, researchers should:

  • Test activity on a panel of synthetic peptides with systematic variations in the lipobox motif

  • Analyze lipid donor preferences using various phospholipid species

  • Compare kinetic parameters (Km, kcat) across a temperature range to identify optimum conditions

What catalytic residues are essential for F. nodosum Lgt activity?

Based on conservation patterns across bacterial Lgt proteins, the catalytic mechanism of F. nodosum Lgt likely involves several essential residues:

  • Conserved Histidine Residues: Typically 1-3 histidines participate in the catalytic mechanism, potentially acting as a base to activate the thiol group of the substrate cysteine.

  • Arginine/Lysine Residues: Positively charged residues may interact with the phosphate group of the phospholipid donor.

  • Hydrophobic Binding Pocket: For accommodating the diacylglycerol moiety.

A systematic site-directed mutagenesis approach targeting these residues would confirm their importance in F. nodosum Lgt. Each mutant should be assessed for:

  • Expression levels and proper folding (by circular dichroism)

  • Membrane association (by fractionation studies)

  • Catalytic activity (using the radiometric assay described earlier)

Comparing the effects of identical mutations in mesophilic versus thermophilic Lgt would further illuminate adaptation-specific features of the catalytic mechanism .

How can F. nodosum Lgt be utilized as a selection marker in expression systems?

F. nodosum Lgt can be adapted as a non-antibiotic selection marker for expression systems similar to the lgt-based selection system developed for E. coli and V. cholerae . This approach involves:

  • Creating a Host Strain with Deleted lgt: Generate an F. nodosum strain or alternative host with a chromosomal lgt deletion complemented by a temperature-sensitive plasmid carrying the lgt gene.

  • Designing Expression Vectors: Construct expression vectors carrying both your gene of interest and the F. nodosum lgt gene.

  • Selection Process: Transform the lgt-deleted strain with the expression vector and select transformants by growth at non-permissive temperatures (e.g., 39°C for E. coli-based systems).

This selection system offers several advantages:

  • Elimination of antibiotic resistance markers, important for pharmaceutical protein production

  • Extremely high plasmid stability without selective pressure

  • Compatibility with industrial-scale production

The thermostable nature of F. nodosum Lgt may offer extended utility in expression systems designed to operate at elevated temperatures .

What strategies can overcome potential toxicity issues when expressing F. nodosum Lgt in heterologous hosts?

Expression of membrane proteins like F. nodosum Lgt in heterologous hosts can present toxicity challenges. To overcome these issues:

  • Tightly Regulated Expression: Use stringent promoters with minimal leaky expression, such as the arabinose-inducible ara promoter or tet promoter systems.

  • Fusion Partners: Incorporate solubility-enhancing fusion partners (MBP, SUMO, or TrxA) that can be later removed via specific protease cleavage.

  • Low Temperature Induction: Induce at reduced temperatures (16-20°C) to slow protein production and facilitate proper folding.

  • Host Strain Optimization: Select specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3).

  • Co-expression Strategies: Co-express chaperones (GroEL/GroES) to assist proper folding or consider co-expressing partner proteins that may stabilize Lgt.

When designing expression constructs, placing the F. nodosum lgt gene under the control of a temperature-regulated promoter may offer additional flexibility in managing expression levels and potential toxicity .

How can recombinant F. nodosum Lgt be utilized for in vitro lipoprotein production?

Recombinant F. nodosum Lgt can be employed for in vitro lipidation of proteins, offering advantages for producing lipidated proteins for structural studies, vaccine development, and functional characterization. A protocol for in vitro lipidation would involve:

  • Reaction Components:

    • Purified F. nodosum Lgt (10-50 μg/ml)

    • Target preprolipoprotein (containing appropriate lipobox)

    • Phospholipid donor (preferably mimicking native F. nodosum membrane composition)

    • Buffer system (typically phosphate buffer, pH 7.5-8.0)

    • Detergent at concentrations above CMC

  • Reaction Conditions:

    • Incubation at 60-70°C (leveraging thermostability)

    • Reaction time of 2-4 hours

    • Gentle agitation to maintain homogeneity

  • Product Purification:

    • Size exclusion chromatography to remove enzyme and unreacted components

    • Verification of lipidation by mass spectrometry

The thermostable nature of F. nodosum Lgt allows reactions to be performed at elevated temperatures, potentially increasing reaction rates and reducing contamination risks compared to mesophilic enzymes. This system could be particularly valuable for producing thermostable lipidated proteins for industrial applications .

What are common challenges in expressing soluble, active F. nodosum Lgt and how can they be addressed?

Researchers working with F. nodosum Lgt may encounter several challenges:

ChallengePotential CausesSolutions
Low expression levelsCodon bias, toxicity, promoter strengthOptimize codons for host, use tightly regulated promoters, lower induction temperature
Inclusion body formationMisfolding, overexpression, improper membrane targetingReduce expression rate, co-express chaperones, optimize signal sequence
Poor membrane insertionHydrophobic mismatch, improper targetingAdd appropriate signal sequences, optimize membrane composition
Inadequate solubilizationInappropriate detergent choiceTest multiple detergents (DDM, LDAO, LMNG) at various concentrations
Loss of activity during purificationDetergent effects, cofactor lossInclude stabilizing lipids in purification buffers, perform activity assays at intermediate steps

For thermophilic proteins like F. nodosum Lgt, consider initial cell growth at 37°C followed by a heat shock period (42-45°C) prior to induction, which may prepare cellular chaperone machinery to better handle thermostable protein folding .

How can expression yields of recombinant F. nodosum Lgt be optimized for structural studies?

To achieve the high yields required for structural studies (crystallography, cryo-EM, or NMR):

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta)

    • Evaluate various expression vectors with different promoter strengths

    • Consider alternative expression hosts (Pseudomonas, insect cells) if E. coli yields remain low

  • Culture Conditions:

    • Implement auto-induction media for gradual protein expression

    • Optimize cell density at induction (typically OD600 of 0.6-0.8)

    • Extend expression time at lower temperatures (16-20°C for 18-24 hours)

  • Fusion Strategies:

    • Test N-terminal fusions (His10, MBP, SUMO) that enhance solubility

    • Include a TEV protease cleavage site for tag removal

  • Scale-up Considerations:

    • Maintain consistent aeration during scale-up (critical for membrane protein expression)

    • Implement fed-batch cultivation to achieve higher cell densities

For crystallography specifically, consider adding thermostabilizing mutations or using antibody fragments as crystallization chaperones to enhance crystal packing of this membrane protein .

What analytical methods are most informative for assessing the quality of purified F. nodosum Lgt?

Multiple complementary analytical techniques should be employed to comprehensively assess purified F. nodosum Lgt quality:

  • Purity Assessment:

    • SDS-PAGE with Coomassie staining (>95% homogeneity)

    • Western blotting with anti-His antibodies

    • Analytical size exclusion chromatography to detect aggregation

  • Structural Integrity:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

    • Thermal shift assays to determine stability and optimal buffer conditions

  • Functional Characterization:

    • Enzymatic activity assays (as described in question 2.3)

    • Substrate binding studies using isothermal titration calorimetry

    • Native mass spectrometry to confirm lipid/detergent binding

  • Homogeneity Analysis:

    • Dynamic light scattering to assess size distribution

    • Multi-angle light scattering to determine oligomeric state

    • Negative-stain electron microscopy for visual inspection

When working with membrane proteins like F. nodosum Lgt, it's particularly important to monitor detergent content throughout purification, as excess detergent can interfere with both structural studies and activity assays .

How does the mechanism of F. nodosum Lgt compare to Lgt enzymes across diverse bacterial phyla?

Comparing F. nodosum Lgt to homologs across bacterial phyla reveals evolutionary adaptations in lipoprotein processing:

  • Sequence Conservation Analysis:

    • Core catalytic residues are likely conserved across all bacterial Lgt proteins

    • Thermophilic adaptations (increased charged residues, disulfide bridges) would distinguish F. nodosum Lgt

    • Membrane-interacting regions may show greater diversity reflecting different cell envelope architectures

  • Substrate Recognition Differences:

    • Signal peptide preferences vary between Gram-positive and Gram-negative bacteria

    • F. nodosum likely shows adaptations specific to its unique cell wall architecture

    • The lipobox consensus sequence ([LVI][ASTVI][GAS][C]) is generally conserved but with phylum-specific preferences

  • Functional Redundancy:

    • In some Gram-positive bacteria like Corynebacterium glutamicum, lgt is non-essential

    • In Gram-negative bacteria like E. coli, lgt is essential

    • F. nodosum's position as a deeply branching bacterial lineage makes its Lgt particularly valuable for understanding evolutionary relationships

Researchers investigating these comparative aspects should employ phylogenetic analyses alongside biochemical characterization to establish evolutionary relationships among Lgt enzymes .

What insights can structural studies of F. nodosum Lgt provide about membrane protein adaptation to extreme environments?

Structural characterization of F. nodosum Lgt offers valuable insights into thermophilic adaptation mechanisms:

  • Membrane Interface Adaptations:

    • Modified hydrophobic thickness to match thermophilic membranes

    • Specialized interfacial residues to interact with more rigid membrane environments

    • Potential specific lipid binding sites that contribute to stability

  • Thermostability Features:

    • Increased intrahelical hydrogen bonding in transmembrane segments

    • Enhanced electrostatic networks at solvent-exposed surfaces

    • Strategically positioned proline residues to reduce conformational flexibility

  • Catalytic Mechanism Adaptations:

    • Potentially more rigid active site with reduced conformational changes during catalysis

    • Adaptations for substrate binding at elevated temperatures

    • Modified water coordination network around catalytic residues

Techniques to explore these features include:

  • X-ray crystallography or cryo-EM for high-resolution structural determination

  • Molecular dynamics simulations at elevated temperatures

  • Hydrogen-deuterium exchange mass spectrometry to assess conformational stability

The structural insights gained may be applicable to engineering other membrane proteins for enhanced thermostability in biotechnological applications .

How can F. nodosum Lgt be engineered for enhanced catalytic efficiency or altered substrate specificity?

Protein engineering approaches for modifying F. nodosum Lgt properties include:

  • Rational Design Strategies:

    • Site-directed mutagenesis of active site residues to modify substrate recognition

    • Introduction of disulfide bonds to enhance stability while maintaining flexibility

    • Modification of membrane-interacting regions to optimize integration in expression hosts

  • Directed Evolution Approaches:

    • Error-prone PCR to generate variant libraries

    • Selection system based on complementation of lgt-deficient strains

    • High-throughput screening for variants with desired properties

  • Target Modifications for Improved Properties:

    • Enhanced thermostability for industrial applications

    • Broadened substrate specificity for biotechnological applications

    • Altered lipid donor specificity for producing novel lipoproteins

  • Chimeric Enzyme Construction:

    • Domain swapping between F. nodosum Lgt and mesophilic counterparts

    • Fusion of catalytic domains with substrate-binding domains from other enzymes

The resulting engineered enzymes could find applications in:

  • Production of novel lipidated proteins for vaccine development

  • Synthesis of lipopeptides with antimicrobial properties

  • Development of thermostable biocatalysts for industrial lipid modifications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.