Recombinant Finegoldia magna Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Finegoldia magna Prolipoprotein Diacylglyceryl Transferase (lgt)

Recombinant Finegoldia magna prolipoprotein diacylglyceryl transferase (lgt) is a bioengineered enzyme derived from the Gram-positive anaerobic bacterium Finegoldia magna. This enzyme catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to prolipoproteins, a critical step in bacterial lipoprotein biosynthesis. The recombinant form is produced via heterologous expression in hosts such as E. coli or yeast systems, enabling scalable production for research and diagnostic applications .

Functional Role in Bacterial Physiology

Lgt is essential for bacterial growth, as lipoproteins anchor membrane proteins and participate in cell wall synthesis, nutrient uptake, and virulence . In F. magna, lipoproteins may contribute to colonization and evasion of host immune responses, though direct evidence linking lgt to pathogenicity remains limited .

ELISA-Based Detection

Recombinant F. magna lgt is commercialized as an antigen for immunoassays:

ApplicationDetails
ELISA KitsDetects anti-lgt antibodies in serum or other biological samples
Tag SystemsTag type determined during production (e.g., His-tag, GST-tag)
StorageTris-based buffer with 50% glycerol at -20°C or -80°C

Biochemical Studies

The recombinant enzyme enables:

  1. Enzymatic activity assays: Measuring diacylglyceryl transferase activity in vitro.

  2. Structural analysis: Crystallization or cryo-EM studies to resolve conformational dynamics.

  3. Vaccine development: Testing as a candidate antigen for targeting F. magna infections .

Genomic Context in F. magna

The lgt gene (FMG_0892) is part of a conserved operon in F. magna ATCC 29328, linked to lipoprotein synthesis and membrane biogenesis . Genome-wide analyses reveal:

FeatureDetails
Genomic LocationChromosomal locus FMG_0892
Adjacent GenesTransporters, aminopeptidases, and other membrane proteins
Pathogenicity LinkProximity to virulence factors (e.g., albumin-binding proteins)

Sequence Conservation

OrganismSequence Identity to F. magna lgtKey Divergence
E. coli~30%Periplasmic domain residues
Streptococcus suis~25%Signal peptide region
Bacillus subtilis~20%Membrane-spanning helices

Challenges and Research Gaps

  1. Structural Elucidation: No published crystal structures exist for F. magna lgt, limiting mechanistic insights.

  2. Pathogenic Relevance: The enzyme’s role in F. magna infections remains uncharacterized, unlike surface proteins like FAF or L .

  3. Therapeutic Targeting: No inhibitors are reported for lgt, though its essentiality in Gram-positive bacteria suggests potential for antimicrobial development .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery times.
All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
lgt; FMG_0892; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Finegoldia magna (strain ATCC 29328) (Peptostreptococcus magnus)
Target Names
lgt
Target Protein Sequence
MDRVAFSIFGIDIMWYGILITLGVILGYVVAVKLAKMENISENTILDILVWALPLAIVGA RAYYVIFEWDYYSKNLGEIIDIRGGGLAIYGGIIAAVITCYVICKKKNLKFLKMLDIFMP AIALGQAIGRWGNFINKEAYGTPTNLPWAITIDGVKVHPTFLYESLGDFLIFLLLVYVFK NRKKFNGQITSMYMILYGILRFFVEGLRTDSLYIGALRVSQLVSIAIIIAGVILQIKYKK QIIKSDEK
Uniprot No.

Target Background

Function
Recombinant Finegoldia magna Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical reaction catalyzed by Lgt and what are its essential substrates?

Lgt catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates, forming a thioether bond. This reaction is the first and critical step in bacterial lipoprotein biogenesis . The enzyme requires two primary substrates: phosphatidylglycerol (the lipid donor) and prolipoproteins containing a conserved cysteine within a recognition sequence often called the "lipobox" . The reaction generates glycerol phosphate as a byproduct, which can be detected in biochemical assays to measure Lgt activity. When using racemic phosphatidylglycerol substrates in biochemical assays, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) are released .

How does bacterial Lgt structure relate to its membrane localization and function?

Lgt is an integral membrane protein that contains multiple transmembrane domains, positioning it correctly within the bacterial membrane to access both the phosphatidylglycerol substrate in the membrane and the prolipoprotein substrates. Recent research has revealed significant insights into the mechanisms of diacylglyceryl modification by Lgt, including structural elements that facilitate substrate binding and catalysis . While most research has focused on Gram-negative bacterial Lgt (particularly from E. coli), the enzyme likely adopts similar structural configurations across bacterial species, with the active site positioned to coordinate the interaction between membrane phospholipids and prolipoprotein substrates.

What biochemical assays are most effective for measuring Lgt activity in vitro?

Several complementary approaches can be employed to assess Lgt activity:

  • Glycerol phosphate release assay: This method measures the release of glycerol phosphate, a byproduct of the Lgt-catalyzed reaction. The detection can be coupled to a luciferase reaction for quantitative measurement . When using racemic phosphatidylglycerol substrates, both G1P and G3P are released and can be detected.

  • Substrate-product analysis: Western blot detection of unmodified prolipoproteins versus diacylglyceryl-modified forms can provide direct evidence of Lgt activity. The accumulation of unmodified prolipoproteins (UPLP) indicates inhibition or depletion of Lgt .

  • Peptide substrate assays: Synthetic peptide substrates derived from lipoproteins (such as Pal-IAAC, where C is the conserved cysteine modified by Lgt) can be used to assess enzyme activity . The specificity of this reaction can be confirmed using mutant peptides where the conserved cysteine is replaced with alanine, which prevents modification by Lgt.

How can genetic depletion systems be designed to study Lgt essentiality and function?

Engineering inducible Lgt depletion systems provides valuable tools for studying enzyme function. Based on published research, effective approaches include:

  • Arabinose-inducible promoter control: Replacing the native lgt promoter with an arabinose-inducible promoter allows for conditional expression. In the absence of arabinose, Lgt expression is repressed, enabling the study of depletion phenotypes .

  • Complementation studies: The lethality of Lgt depletion can be confirmed through genetic complementation with functional Lgt, providing evidence for on-target effects .

  • Downstream gene expression monitoring: When engineering Lgt depletion systems, it's important to confirm that the expression of downstream genes (like thyA, which may have overlapping regulatory elements with lgt) remains unaffected to avoid confounding effects .

Using these systems, researchers can demonstrate that Lgt depletion leads to outer membrane permeabilization, increased sensitivity to serum killing, and enhanced antibiotic susceptibility .

What screening strategies have successfully identified Lgt inhibitors?

Recent research has identified the first Lgt inhibitors through carefully designed screening approaches:

  • Binding screens: Affinity selection of compounds binding to purified Lgt has proven successful. For example, macrocyclic peptides binding to E. coli Lgt-biotin in detergent solutions (0.02% n-dodecyl β-D-maltoside) have been used for inhibitor discovery .

  • Biochemical activity assays: High-throughput screening using the glycerol phosphate release assay coupled to detection systems allows for identification of compounds that inhibit enzymatic activity .

  • Validation criteria: True Lgt inhibitors should demonstrate:

    • Inhibition of Lgt biochemical activity in vitro (measured by IC50 values)

    • Bactericidal activity against wild-type bacterial strains

    • Phenotypes consistent with genetic Lgt depletion

    • Accumulation of unmodified prolipoprotein substrates

How can researchers distinguish specific Lgt inhibition from off-target effects?

Differentiating specific Lgt inhibition from off-target effects requires multiple lines of evidence:

  • Biochemical assays: Compounds should potently inhibit Lgt enzymatic activity in vitro. For example, compounds G9066, G2823, and G2824 inhibit Lgt with IC50 values of 0.24 μM, 0.93 μM, and 0.18 μM, respectively .

  • Phenotypic comparison: Effects of chemical inhibition should mirror those observed with genetic depletion of Lgt. This includes similar patterns of prolipoprotein accumulation and membrane permeabilization .

  • Western blot analysis: Specific inhibition of Lgt should lead to accumulation of unmodified prolipoproteins (UPLP) rather than diacylglyceryl-modified forms, which can be detected by Western blot .

  • Cellular fractionation: Sucrose gradient centrifugation or sarkosyl treatment can separate membrane fractions to demonstrate shifts in lipoprotein localization consistent with Lgt inhibition .

  • Comparative analysis with inhibitors of other lipoprotein processing steps: Lgt inhibitors should produce distinct patterns of lipoprotein accumulation compared to inhibitors targeting other steps in the pathway (like LspA or LolCDE inhibitors) .

What membrane fractionation methods are most effective for studying Lgt and its lipoprotein substrates?

Several complementary approaches can effectively separate bacterial membrane components for Lgt studies:

  • Sucrose gradient centrifugation: This technique efficiently separates inner and outer membranes in Gram-negative bacteria, allowing detection of Lgt and its substrates in different membrane compartments . Effective separation can be verified using marker proteins such as MsbA (inner membrane) and OmpA (outer membrane).

  • Sarkosyl solubilization: Sarkosyl specifically solubilizes the inner membrane and has been used successfully for inner membrane proteomic analyses in multiple Gram-negative bacteria . This approach can reveal the accumulation of lipoprotein intermediates in specific membrane compartments.

  • SDS fractionation: This method separates SDS-insoluble peptidoglycan-associated proteins (PAP) from SDS-soluble non-peptidoglycan-associated proteins (non-PAP), providing insight into lipoprotein-peptidoglycan interactions .

How can Western blot analysis be optimized to detect various lipoprotein forms after Lgt inhibition?

Western blot analysis is a critical technique for distinguishing between different lipoprotein forms:

  • Sample preparation: Careful separation of membrane fractions using techniques described above enhances detection of specific lipoprotein forms.

  • Identification of lipoprotein forms: Research has identified several distinct lipoprotein forms that can be detected by Western blot:

    • Unmodified prolipoprotein (UPLP): The substrate of Lgt that accumulates when Lgt is inhibited or depleted

    • Diacylglyceryl-modified prolipoprotein (DGPLP): The product of Lgt that serves as substrate for LspA

    • Peptidoglycan-linked forms: Various forms of lipoproteins linked to peptidoglycan

  • Positive controls: Including samples from strains with known genetic depletions of Lgt, LspA, or LolCDE helps identify specific lipoprotein forms .

  • Lysozyme treatment: Addition of lysozyme helps identify peptidoglycan-linked lipoprotein forms, as previously demonstrated in research protocols .

Lipoprotein FormMigration PatternCharacteristicsAccumulates After
Unmodified pro-Lpp (UPLP)Slowest migrationNot modified by LgtLgt inhibition/depletion
Diacylglyceryl pro-Lpp (DGPLP)IntermediateModified by Lgt, not by LspALspA inhibition/depletion
Triacylated mature LppFastest migrationModified by both Lgt and LspANormal processing
PG-linked Lpp formsVariableCrosslinked to peptidoglycanDetected in PAP fraction

How can researchers engineer conditional expression systems to study Lgt essentiality?

Conditional expression systems provide powerful tools for studying essential genes like lgt:

  • Arabinose-inducible promoter replacement: Engineering strains where the only copy of lgt is under control of an arabinose-inducible promoter allows for tight regulation of Lgt expression . The strain CFT073 Δlgt described in research required arabinose for Lgt expression and growth.

  • Complementation testing: To verify the specificity of growth defects, complementation with plasmid-encoded lgt can be performed. Research has demonstrated that growth defects after Lgt depletion were rescued after complementation with E. coli lgt .

  • Monitoring downstream effects: When manipulating lgt, it's important to confirm that the expression of downstream genes remains unaffected. For example, thyA expression, which is regulated by transcription from the lgt promoter and translational coupling, should be monitored to ensure it remains unchanged after Lgt depletion .

What are the key considerations when designing genetic deletion studies involving lipoprotein processing genes?

Genetic deletion studies of lipoprotein processing genes require careful experimental design:

  • Essential gene considerations: Since lgt is often essential, complete deletion may not be viable. Instead, conditional depletion systems or partial deletions may be necessary .

  • Downstream gene effects: Genetic manipulations should not disrupt the expression of downstream genes. For instance, the thyA gene is downstream of lgt and its ribosome binding site overlaps with the lgt stop codon, requiring careful genetic manipulation strategies .

  • Suppressor mutations: When studying lipoprotein processing genes, researchers should consider potential suppressor mutations. Interestingly, unlike inhibition of other steps in lipoprotein biosynthesis, deletion of the major outer membrane lipoprotein, lpp, is not sufficient to rescue growth after Lgt depletion or provide resistance to Lgt inhibitors .

  • Double deletion studies: Creating double deletion mutants (e.g., Δlgt Δlpp) can provide insight into the genetic interactions between lipoprotein processing genes and their substrates .

How do mutations in conserved cysteine residues affect Lgt substrate recognition and modification?

The conserved cysteine residue in prolipoprotein substrates is critical for Lgt function:

  • Mutation consequences: Research has demonstrated that mutation of the conserved cysteine to alanine (e.g., in Pal-IAA instead of Pal-IAAC) prevents modification by Lgt . This confirms the absolute requirement for this cysteine residue in the modification process.

  • Peptidoglycan linkage effects: Studies with Lpp C21A (where the conserved cysteine is mutated to alanine) showed significantly reduced peptidoglycan association compared to wild-type Lpp . This indicates that diacylglyceryl modification by Lgt is important for efficient cross-linking of lipoproteins to peptidoglycan.

  • Recognition motif: The lipobox motif (typically [LVI][ASTVI][GAS]C) preceding the conserved cysteine is recognized by Lgt. Mutations in this region can affect the efficiency of substrate recognition and modification.

What structural elements of the Lgt active site are critical for inhibitor binding?

Understanding the structural features of Lgt's active site is essential for inhibitor development:

  • Phosphatidylglycerol binding site: Inhibitors may target the conserved phosphatidylglycerol binding site in Lgt. Research suggests that if inhibitors bind to this highly conserved site, mutations that disrupt inhibitor binding might also impair enzyme function .

  • Resistance development: Unlike some other antibiotic targets, no on-target resistance mutations have been described for Lgt inhibitors . This is consistent with the hypothesis that the inhibitors bind to essential, conserved regions of the enzyme.

  • Competitive vs. non-competitive inhibition: Further studies are needed to determine if Lgt inhibitors competitively inhibit binding of phosphatidylglycerol or prolipoprotein substrates . This information would be critical for understanding the mechanism of inhibition and designing improved inhibitors.

How does Lgt inhibition affect bacterial membrane integrity and antibiotic susceptibility?

The inhibition or depletion of Lgt has profound effects on bacterial physiology:

  • Membrane permeabilization: Lgt depletion leads to permeabilization of the outer membrane in Gram-negative bacteria .

  • Increased antibiotic sensitivity: Bacteria with inhibited or depleted Lgt show increased sensitivity to antibiotics, suggesting that Lgt inhibitors could potentially be used in combination with existing antibiotics .

  • Serum sensitivity: Lgt-depleted bacteria exhibit increased sensitivity to serum killing, indicating compromised outer membrane integrity .

  • Lipoprotein mislocalization: Inhibition of Lgt leads to decreased levels of lipoproteins (including Lpp, Pal, and BamD) in the outer membrane, as well as reduced levels of outer membrane β-barrel proteins like BamA and OmpA . This widespread effect on outer membrane protein localization likely contributes to the observed membrane defects.

What are the differences in cellular effects between inhibiting Lgt versus other lipoprotein processing enzymes?

Inhibition of different steps in lipoprotein processing produces distinct cellular effects:

  • Differential accumulation of intermediates: While LspA inhibition leads to accumulation of diacylglyceryl-modified prolipoprotein (DGPLP) in the inner membrane (approximately 86-fold increase), Lgt inhibition results in accumulation of unmodified prolipoprotein (UPLP) but with minimal accumulation of other PG-linked Lpp forms .

  • Resistance mechanisms: A key finding is that deletion of lpp provides resistance to inhibitors of downstream steps in lipoprotein biosynthesis (like LspA inhibitors) but does not confer resistance to Lgt inhibitors . This suggests that Lgt inhibition has a broader impact beyond effects on individual lipoproteins like Lpp.

  • Peptidoglycan association: Lgt inhibition leads to decreased peptidoglycan association of lipoproteins, suggesting that efficient cross-linking to peptidoglycan occurs primarily after diacylglyceryl modification of lipoprotein substrates .

Inhibitor TargetAccumulated IntermediateResistance by ΔlppEffect on PG Association
LgtUnmodified prolipoprotein (UPLP)NoSignificantly decreased
LspADiacylglyceryl prolipoprotein (DGPLP)YesAccumulation of PG-linked forms
LolCDEMature lipoproteins in IMYesNot directly affected

How can mechanistic understanding of Lgt function inform new antibiotic development strategies?

The unique properties of Lgt make it a promising target for antibiotic development:

  • Novel target advantage: Lgt inhibitors represent a new class of antibacterial agents with a mechanism distinct from currently available antibiotics .

  • Resistance barrier: Unlike inhibitors of other steps in lipoprotein biosynthesis, Lgt inhibitors are not rendered ineffective by deletion of lpp, which is a common resistance mechanism for other lipoprotein processing inhibitors . This suggests a potentially higher barrier to resistance development.

  • Broad-spectrum potential: Lgt inhibitors have demonstrated bactericidal activity against multiple Gram-negative bacteria, including E. coli and A. baumannii , suggesting potential broad-spectrum applications.

  • Combination therapy opportunities: Since Lgt inhibition increases sensitivity to other antibiotics, combination approaches could enhance efficacy and potentially reduce resistance development .

What techniques can be employed to develop selective inhibitors that target bacterial Lgt without affecting human enzymes?

Developing selective Lgt inhibitors requires sophisticated approaches:

  • Structure-based design: Understanding the structural differences between bacterial Lgt and any similar human enzymes can guide the design of selective inhibitors. Recent publications have provided significant insights into potential mechanisms of diacylglyceryl modification by Lgt .

  • Biochemical screening assays: The glycerol phosphate release assay described in research can be used to screen compound libraries for Lgt inhibition while counter-screening against human enzymes .

  • Affinity selection approaches: Techniques like the selection of macrocyclic peptides binding to Lgt can identify molecules with high specificity for the bacterial target . These approaches typically use purified Lgt protein in detergent solutions.

  • Phenotypic confirmation: True Lgt inhibitors should reproduce the phenotypic effects of genetic Lgt depletion, including specific patterns of prolipoprotein accumulation .

What are the critical parameters for optimizing recombinant expression and purification of active Lgt?

Successful expression and purification of functional Lgt requires attention to several key factors:

  • Detergent selection: Research has used n-dodecyl β-D-maltoside (DDM) at 0.02% concentration for maintaining Lgt solubility and activity . The choice of detergent is critical for membrane protein purification.

  • Tagging strategies: Biotin tagging has been successfully employed for Lgt purification and use in binding assays . Other affinity tags may also be suitable depending on the specific application.

  • Expression systems: While specific details for Finegoldia magna Lgt are not provided in the search results, successful expression of E. coli Lgt suggests that standard bacterial expression systems can be adapted for recombinant Lgt production.

  • Activity verification: Following purification, it's essential to confirm that the recombinant enzyme retains activity using biochemical assays such as the glycerol phosphate release assay .

How can peptide substrate design be optimized for Lgt activity assays?

Peptide substrate design is critical for developing reliable Lgt activity assays:

  • Minimal recognition sequence: Research has used peptide substrates derived from the Pal lipoprotein (Pal-IAAC), where the C-terminal cysteine is the site of modification by Lgt . This suggests that relatively short peptides containing the lipobox motif and conserved cysteine are sufficient for Lgt recognition.

  • Negative controls: Mutant peptides where the conserved cysteine is replaced with alanine (e.g., Pal-IAA) serve as excellent negative controls that should not be modified by Lgt .

  • Detection strategies: Coupled assay systems that detect the glycerol phosphate byproduct of the Lgt reaction provide a quantitative measure of enzyme activity . These can be linked to luciferase-based detection for high sensitivity.

What emerging technologies might enhance our understanding of Lgt structure and function?

Several cutting-edge approaches could advance Lgt research:

  • Cryo-electron microscopy: This technique could provide high-resolution structural information about Lgt in its native membrane environment, improving our understanding of substrate binding and catalysis.

  • Targeted protein degradation approaches: New methods to achieve rapid protein depletion could provide complementary approaches to genetic depletion studies, allowing temporal control over Lgt removal.

  • Advanced lipidomics: More sophisticated methods to analyze membrane lipid composition could reveal additional effects of Lgt inhibition or depletion on bacterial membrane architecture.

  • In situ labeling techniques: Methods to visualize lipoprotein processing in living bacteria could provide dynamic information about Lgt function and inhibition.

How might inhibition of multiple steps in lipoprotein processing enhance antibacterial strategies?

Combination approaches targeting the lipoprotein processing pathway present intriguing possibilities:

  • Synergistic inhibition: Combining inhibitors of Lgt with inhibitors of other steps in lipoprotein processing might produce synergistic effects by more completely disrupting lipoprotein biogenesis.

  • Resistance prevention: Since different steps in the pathway have distinct resistance mechanisms (e.g., lpp deletion provides resistance to LspA inhibitors but not Lgt inhibitors ), combination approaches might reduce the likelihood of resistance development.

  • Membrane disruption enhancement: Simultaneous inhibition of multiple steps in lipoprotein processing could more severely compromise membrane integrity, potentially increasing efficacy against difficult-to-treat bacteria.

  • Species-specific targeting: Differences in lipoprotein processing pathways between bacterial species might allow for tailored combination approaches with enhanced specificity for particular pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.