Recombinant Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Flagellar Biosynthetic Protein FlhB

Recombinant Flagellar Biosynthetic Protein FlhB (flhB) is a genetically engineered variant of the FlhB protein, a critical component of the bacterial flagellar type III secretion system (fT3SS). FlhB plays a pivotal role in substrate specificity switching during flagellar assembly, enabling the sequential export of rod, hook, and filament components . Recombinant FlhB is produced through heterologous expression systems (e.g., E. coli, yeast, baculovirus) to study its structure, function, and applications in bacterial motility and virulence .

Domain Architecture

FlhB consists of two domains:

  • Transmembrane domain (TMD): Anchors FlhB to the inner membrane and interacts with the FliPQR export gate .

  • Cytoplasmic domain (FlhB-C): Undergoes autocleavage at the conserved NPTH motif, generating FlhB-CN and FlhB-CC subdomains .

DomainKey FeaturesFunctional Role
TMDMembrane-embedded; part of the FliPQR-FlhB complexFacilitates substrate translocation through the export gate .
FlhB-CAutocleaves into FlhB-CN/FlhB-CC; contains a proline-rich region (PRR) at C-terminusRegulates substrate switching via interactions with FliK and FlhA .

Autocleavage and Substrate Switching

  • Autocleavage at NPTH is essential for transitioning from rod/hook to filament protein secretion .

  • Mutations (e.g., N269A) block autocleavage, leading to defective filament formation ("polyhook" phenotype) .

Recombinant Expression Systems

Recombinant FlhB has been expressed in diverse systems:

Host SystemSpeciesApplicationsReferences
E. coliSalmonella typhimuriumStructural studies, interaction assays with FliK/FlhA
YeastHelicobacter pyloriAntigen production for vaccine research
Baculovirus/MammalianVibrio mimicusCryo-EM studies of FliPQR-FlhB complex

Key Challenges:

  • Autocleavage efficiency: Thermostability and codon bias affect cleavage rates in non-native hosts .

  • PRR functionality: Deletion of the proline-rich region reduces flagellar assembly efficiency by ~30% .

Mechanistic Studies

  • Substrate Specificity:

    • FlhB interacts with FliK to measure hook length and trigger secretion switching .

    • The PRR enhances export efficiency of hook/filament proteins (e.g., FlgB, FlgE) .

  • Structural Data:

    • Cryo-EM of Vibrio mimicus FlhB revealed its integration into the FliPQR-FlhB core complex (EMD-10093) .

    • Crystal structures highlight the PRR’s "wave-like" motif, critical for binding cytoplasmic partners .

Biotechnological Applications

  • Vaccine Development:

    • Recombinant H. pylori FlhB (aa 1–358) is explored as a vaccine target due to its role in pathogenesis .

  • Antimicrobial Targets:

    • FlhB inhibitors could disrupt flagellar motility in pathogens like Salmonella and Yersinia .

Current Limitations

  • Heterologous expression often yields incomplete autocleavage, necessitating mutagenesis for functional studies .

  • Structural dynamics of FlhB-C during substrate switching remain poorly resolved .

Emerging Opportunities

  • Engineering Chimeric FlhB:

    • Hybrid proteins (e.g., Aquifex-Salmonella chimeras) enable cross-species functional analyses .

  • High-Throughput Screening:

    • PRR-targeted compounds could modulate T3SS activity in pathogenic bacteria .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance for arrangement and associated charges.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your formulation.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
flhB; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Yersinia enterocolitica
Target Names
flhB
Target Protein Sequence
MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAAM IAQGLHFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVIVAMAVPMLLGGVLFSGES IKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAPPV AALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALR IRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLI PKKPEHLPVPEGLDFATEESETD
Uniprot No.

Target Background

Function
Essential for the formation of the rod structure in the basal body of the flagellar apparatus. In conjunction with FliI and FliH, it may constitute the export apparatus for flagellin.
Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic domain structure of FlhB protein and how does it relate to function?

FlhB consists of two primary structural domains that contribute to its functionality in the flagellar system:

  • The N-terminal transmembrane domain (FlhB-TMD): Forms part of the export gate complex with FliPQR and is involved in regulating substrate passage through the type III secretion system (T3SS).

  • The cytoplasmic domain (FlhB-C): Located after the transmembrane domain and undergoes autocleavage at a conserved NPTH motif, resulting in two tightly associated subdomains:

    • FlhB-CN: The N-terminal subdomain after cleavage

    • FlhB-CC: The C-terminal subdomain after cleavage

This domain organization is critical for understanding FlhB's function in switching export specificity of the flagellar T3SS upon hook completion, thereby coordinating flagellar gene expression with assembly . The cytoplasmic domain contains specialized regions including a proline-rich region (PRR) at the C-terminus that influences autocleavage and flagellar formation .

How does FlhB autocleavage occur and what significance does it have for flagellar assembly?

FlhB undergoes autocleavage between the asparagine and proline residues within the highly conserved NP(T/E)H motif, splitting the cytoplasmic domain into FlhB-CN and FlhB-CC subdomains that remain tightly associated . This process is crucial for flagellar assembly regulation.

The autocleavage mechanism:

  • In Salmonella enterica, cleavage occurs between N269 and P270

  • The presence of the C-terminal proline-rich region (PRR) influences the autocleavage efficiency

  • When the PRR is deleted, diminished FlhB autocleavage is observed

Experimental evidence shows that mutating N269 to alanine completely inhibits autocleavage and prevents flagellar filament formation due to defects in flagellin secretion. Similarly, mutating P270 reduces autocleavage and yields reduced flagellin export . The cleaved form is predominant in wild-type cells, as confirmed by Western blot analysis using C-terminal 3xFLAG tags .

This autocleavage event functions as a molecular switch that changes the substrate specificity of the export apparatus, transitioning from early (rod/hook) to late (filament) substrate secretion in the flagellar assembly process.

What is known about the interaction between FlhB and FliK in controlling hook length?

The interaction between FlhB and FliK represents a critical checkpoint mechanism in flagellar assembly:

  • Direct interaction confirmed: Experimental evidence demonstrates direct physical interaction between FlhB and FliK proteins .

  • Phenotypic evidence: Mutations in either FlhB or deletion of FliK result in similar "polyhook" phenotypes characterized by abnormally extended hook structures without filament formation .

  • Molecular mechanism: When the hook reaches its mature length (~55 nm), FliK interacts with FlhB to trigger a conformational change in cleaved FlhB, switching the export specificity from rod/hook-type substrates to filament-type substrates.

  • Role of the proline-rich region (PRR): Deletion of the PRR at the C-terminus of FlhB results in a unique phenotype where filaments form on top of polyhook structures, indicating that this region is crucial for proper signaling between FliK and FlhB .

Microscopy analysis reveals that FlhB variants with PRR deletion show altered hook formation patterns, demonstrating the importance of this interaction for hook length control and the hook-to-filament transition .

What are the most effective methods for constructing FlhB deletion mutants for functional studies?

Based on successful experimental approaches described in the literature, the following methodological framework is recommended for constructing FlhB deletion mutants:

  • Gene targeting strategy:

    • Use genetic recombination techniques to create precise deletions of flhB gene or specific domains (TMD, CN, CC, or PRR regions)

    • Design primers that flank the target deletion region with appropriate restriction sites

    • Incorporate selectable markers for screening positive recombinants

  • Specific approaches for L. monocytogenes and related bacteria:

    • Homologous recombination using temperature-sensitive shuttle vectors

    • Creation of clean deletion mutants (e.g., CΔflhB) to prevent polar effects on downstream genes

    • Construction of complementation strains to confirm phenotypic restoration

  • Domain-specific modification strategies:

    • Site-directed mutagenesis for targeted amino acid substitutions (e.g., N269A, P270A in the NPTH motif)

    • C-terminal truncations to remove the proline-rich region

    • Addition of epitope tags (e.g., 3xFLAG) for protein detection and quantification

  • Verification methods:

    • PCR amplification and sequencing to confirm correct gene modification

    • Western blotting using antibodies against epitope tags to verify protein expression levels

    • Complementation assays to confirm phenotype is due to the specific mutation

This comprehensive approach allows for systematic analysis of FlhB function through targeted genetic manipulation.

What visualization techniques are most appropriate for studying FlhB-dependent flagellar structures?

Multiple complementary visualization techniques provide comprehensive insights into FlhB-dependent flagellar structures:

  • Fluorescent labeling of flagellar components:

    • Cysteine-specific maleimide labeling of flagellar filaments (using AlexaFluor 488 maleimide) and hooks (using AlexaFluor 568 maleimide)

    • This approach allows for specific visualization of flagellar structures in intact cells

  • Fluorescence microscopy setup:

    • Inverse microscope (e.g., DMI6000B) with appropriate phase contrast objectives (100x/1.4 PH3)

    • Cell Explorer system for enhanced visualization

    • Mounting samples on LM-agarose pads from exponentially growing cultures

  • Electron microscopy for ultrastructural analysis:

    • Transmission electron microscopy for detailed visualization of hook and filament structures

    • Negative staining protocols for enhanced contrast of flagellar components

  • Immunofluorescence for protein localization:

    • Detection of C-ring components (e.g., FliM) to assess basal body assembly

    • Use of fluorescently tagged antibodies against flagellar components

  • Quantitative analysis approaches:

    • Measurement of hook length, filament length, and area using image analysis software

    • Statistical comparison between wild-type and mutant strains using unpaired t-tests

    • Quantification of the percentage of cells displaying hooks and/or filaments

These techniques have been successfully employed to characterize the impact of FlhB mutations (ΔflhB, N269A, ΔPRR, Y376A) on flagellar structure formation as shown in Figure 2 and Figure 3 of the literature .

How can researchers effectively analyze FlhB autocleavage and its variants in laboratory settings?

A systematic approach to analyzing FlhB autocleavage involves multiple complementary techniques:

  • Protein expression and detection system:

    • Generate chromosomal modifications to express FlhB variants with C-terminal epitope tags (e.g., 3xFLAG tag)

    • Create specific mutations at the cleavage site (N269A) or in regulatory regions (ΔPRR, Y376A)

  • SDS-PAGE and Western blotting protocol:

    • Harvest samples from exponentially growing cultures

    • Standardize to OD 10 in 2×SDS sample buffer

    • Load 10 μL per sample on 12.5% SDS gels

    • Transfer to membrane and detect using monoclonal anti-FLAG M2-peroxidase antibodies

    • Use chemiluminescence detection (Western Lightning) for visualization

  • Data interpretation guidelines:

    • Wild-type FlhB: Majority of protein appears in cleaved form

    • N269A variant: Protein appears at the size of non-cleaved FlhB

    • ΔPRR variant: Shows diminished autocleavage

    • Y376A variant: Displays autocleavage pattern similar to wild-type

  • Quantitative analysis:

    • Measure the ratio of cleaved to non-cleaved forms

    • Correlate with phenotypic outcomes (flagellar assembly, motility)

    • Perform statistical analysis to determine significance of differences

This methodological approach provides critical insights into how specific domains or amino acids contribute to FlhB autocleavage efficiency and subsequent flagellar assembly processes.

How does the conservation of FlhB structure across bacterial species inform experimental design?

Phylogenetic analysis of FlhB proteins across bacterial phyla reveals important evolutionary relationships that should inform experimental design:

  • Conservation patterns across bacterial phyla:

    • FlhB proteins form distinct clades corresponding to major bacterial groups

    • The NPTH autocleavage motif is highly conserved across diverse species

    • The proline-rich region (PRR) at the C-terminus shows variable conservation patterns

  • Experimental design implications:

    • When selecting model organisms, consider evolutionary distance and FlhB structural differences

    • Design experiments using a complete or reduced factorial approach based on the number of conserved domains being studied

    • When transferring findings between species, prioritize domains with highest conservation

  • Cross-species validation strategy:

    • Test functional conservation by expressing FlhB from different species in a ΔflhB background

    • Focus on highly conserved regions for site-directed mutagenesis studies

    • Use multiple sequence alignments to identify species-specific variations that may affect function

  • Statistical considerations:

    • Calculate appropriate sample sizes based on expected effect sizes derived from conservation data

    • Consider factorial design approaches when investigating multiple conserved domains simultaneously

    • Account for potential interactions between conserved and variable regions

Understanding the evolutionary relationship among FlhB proteins enables researchers to design more effective experiments and better interpret results across different bacterial systems.

What are the molecular mechanisms by which FlhB coordinates with the C-ring components FliM and FliY?

FlhB exhibits complex functional relationships with C-ring components FliM and FliY that regulate flagellar assembly and motility:

  • Protein expression interdependence:

    • Deletion of flhB results in reduced expression of FliM and FliY proteins

    • Conversely, deletion of fliM or fliY leads to complete abolishment of FlaA (flagellin) expression

    • This indicates a regulatory feedback loop between these components

  • Transcriptional regulation:

    • Transcriptional levels of flagellar-related genes (flaA, fliM, fliY, lmo0695, lmo0698, fliI, fliS) are downregulated in ΔflhB, ΔfliM, or ΔfliY mutants

    • FlhB, FliM, and FliY appear to function in a coordinated manner to regulate flagellar gene expression

  • C-ring assembly dependence:

    • Fluorescence microscopy analysis of FliM localization shows that FlhB variants (N269A, ΔPRR, Y376A) maintain normal C-ring assembly

    • This indicates that FlhB's role in flagellar assembly occurs downstream of C-ring formation

  • Flagellar type switching mechanism:

    • The cytoplasmic domain of FlhB interacts with FliK, which then influences C-ring components

    • This interaction network coordinates the switch from early (rod/hook) to late (filament) substrate specificity

The experimental evidence suggests a complex regulatory network where FlhB serves as a key component in a signal transduction pathway that coordinates gene expression with the physical assembly of flagellar structures.

How do mutations in the proline-rich region (PRR) of FlhB affect both structure and function of the flagellar system?

The proline-rich region (PRR) at the C-terminus of FlhB serves as a critical regulatory element with multiple functional impacts:

  • Effects on flagellar assembly:

    • Deletion of the PRR (ΔPRR) results in a unique phenotype: filaments forming on top of polyhook structures

    • Quantitative analysis shows decreased percentage of cells with hooks and filaments in ΔPRR mutants

    • Significant alterations in hook area measurements compared to wild-type strains

  • Molecular mechanism of action:

    • The PRR influences FlhB autocleavage efficiency, with diminished cleavage observed in ΔPRR variants

    • This suggests the PRR may stabilize the protein conformation required for efficient autocleavage

    • The region likely influences interactions with other flagellar components, particularly FliK

  • Structural implications:

    • The proline-rich nature creates a unique structural element with restricted conformational flexibility

    • This may serve as a molecular ruler or mechanical sensor during the hook-length control process

    • Crystallographic data reveals the structural organization of this region and its relationship to the autocleavage site

  • Species-specific variations:

    • Bioinformatic analysis indicates variable conservation of the PRR across bacterial species

    • This suggests potential adaptation of the PRR to species-specific requirements for flagellar regulation

These findings highlight the PRR as a multifunctional regulatory element that influences both the biochemical properties of FlhB itself and its interactions within the larger flagellar assembly system.

What statistical approaches are most appropriate for analyzing experimental data related to FlhB mutations?

When analyzing data from FlhB mutation studies, researchers should employ these statistical approaches:

  • For quantitative phenotype comparisons:

    • Unpaired t-tests for comparing wild-type vs. single mutant conditions (N269A, ΔPRR, Y376A)

    • Analysis of variance (ANOVA) with post-hoc tests for multiple comparisons across several mutant types

    • Report exact p-values with significance thresholds clearly defined (e.g., * = p-value ≤ 0.0001)

  • For experimental design optimization:

    • Consider factorial design approaches when investigating multiple FlhB domains or mutations

    • Balance between complete factorial designs (testing all combinations) and reduced factorial designs based on research priorities

    • Calculate required sample sizes based on expected effect sizes from preliminary data

  • For image-based quantification:

    • Develop standardized measurement protocols for hook length, filament length, and other structural features

    • Analyze multiple fields of view with consistent cell numbers across experimental conditions

    • Report both mean values and measures of variability (standard deviation or standard error)

  • For protein expression analysis:

    • Use densitometry for quantifying Western blot band intensities

    • Normalize cleaved/uncleaved ratios to account for loading variations

    • Apply appropriate transformations if data does not meet assumptions of parametric tests

These statistical approaches ensure rigorous analysis of FlhB mutation effects while optimizing experimental resources through strategic design choices.

How do researchers reconcile contradictory findings about FlhB function across different bacterial species?

When confronting contradictory findings about FlhB function across bacterial species, researchers should apply the following systematic approach:

  • Phylogenetic context analysis:

    • Map contradictory findings onto the evolutionary tree of FlhB proteins

    • Determine if contradictions align with evolutionary divergence points

    • Consider the possibility that FlhB function has genuinely diversified in different bacterial lineages

  • Methodological reconciliation:

    • Examine differences in experimental approaches (in vivo vs. in vitro, genetic vs. biochemical)

    • Standardize methodological protocols across species when possible

    • Consider how growth conditions might influence flagellar gene expression differently across species

  • Structural-functional correlation:

    • Compare protein sequence and structure variations at key functional sites (e.g., NPTH motif, PRR)

    • Determine if species-specific amino acid substitutions could explain functional differences

    • Use complementation studies across species to test functional conservation directly

  • Contextual protein interaction networks:

    • Map species-specific differences in flagellar protein partners (FliK, FliM, FliY)

    • Consider how variations in these interaction partners might explain contradictory FlhB findings

    • Examine differences in transcriptional regulation networks across bacterial species

This systematic approach allows researchers to determine whether contradictions represent genuine biological variation or methodological differences, leading to more nuanced understanding of FlhB function across bacterial diversity.

What are the best practices for integrating microscopy, genetic, and biochemical data in FlhB research?

Effective integration of diverse data types requires a structured methodological approach:

This integrated approach enables researchers to build a comprehensive understanding of FlhB function from molecular mechanisms to cellular consequences.

What are the most promising approaches for studying FlhB interactions with other flagellar proteins?

Advanced methodologies for investigating FlhB protein interactions include:

  • In situ crosslinking coupled with mass spectrometry:

    • Use chemical crosslinkers to capture transient interactions during flagellar assembly

    • Apply proximity-dependent labeling techniques (BioID, APEX) with FlhB as the bait protein

    • Perform quantitative proteomics to identify interaction partners at different assembly stages

  • Single-molecule fluorescence techniques:

    • Develop fluorescently tagged FlhB variants that maintain normal function

    • Apply Förster Resonance Energy Transfer (FRET) to measure direct interactions with partners

    • Use fluorescence recovery after photobleaching (FRAP) to examine dynamics of FlhB within the export apparatus

  • Cryo-electron tomography approaches:

    • Visualize the full flagellar export apparatus in situ at near-atomic resolution

    • Compare wild-type and mutant structures to determine conformational changes

    • Use subtomogram averaging to enhance resolution of the FlhB-containing export gate

  • Computational prediction and modeling:

    • Apply molecular dynamics simulations to predict conformational changes during autocleavage

    • Use protein-protein docking algorithms to model interactions with FliK and other partners

    • Develop systems biology models of the complete flagellar assembly process

These techniques would provide unprecedented insights into the dynamic interactions that enable FlhB to coordinate flagellar protein export and assembly.

How might novel genetic engineering approaches advance our understanding of FlhB function?

Emerging genetic technologies offer powerful new approaches to study FlhB:

  • CRISPR-Cas9 genome editing applications:

    • Create precise point mutations in the native genomic context

    • Develop inducible FlhB variants to study temporal aspects of function

    • Generate fluorescent protein fusions at the endogenous locus

  • Domain swapping and chimeric protein analysis:

    • Create chimeric FlhB proteins with domains from different bacterial species

    • Test which regions confer species-specific functions

    • Design synthetic FlhB variants with novel regulatory properties

  • Optogenetic control systems:

    • Develop light-controlled FlhB variants to manipulate autocleavage or conformation

    • Create optogenetically regulated interaction between FlhB and FliK

    • Apply spatiotemporal control to study the dynamics of flagellar assembly in vivo

  • Deep mutational scanning approaches:

    • Generate comprehensive libraries of FlhB variants

    • Apply high-throughput screening for motility or flagellar assembly

    • Map the complete mutational landscape to identify critical residues beyond the known NPTH motif and PRR

These genetic engineering approaches would enable unprecedented control and analysis of FlhB function in its native cellular context.

What implications does FlhB research have for understanding bacterial pathogenesis and developing novel antimicrobial strategies?

FlhB research offers significant insights for bacterial pathogenesis and antimicrobial development:

  • Pathogenesis mechanisms involving FlhB:

    • In Listeria monocytogenes, FlhB plays critical roles in flagellar motility, which contributes to virulence

    • The relationship between FlhB and type III secretion systems suggests potential roles in virulence factor secretion

    • Understanding FlhB function may reveal how bacterial pathogens coordinate motility with host invasion

  • Anti-virulence drug development prospects:

    • Target the NPTH autocleavage site to prevent the export specificity switch

    • Develop compounds that disrupt the interaction between FlhB and FliK

    • Design inhibitors targeting the proline-rich region (PRR) to impair flagellar assembly

  • Translational research opportunities:

    • Create high-throughput screening systems to identify FlhB inhibitors

    • Develop attenuated bacterial strains with modified FlhB for vaccine development

    • Engineer commensal bacteria with altered FlhB function for probiotic applications

  • Comparative analysis with virulence-associated secretion systems:

    • Apply lessons from FlhB to understand related proteins in virulence-associated type III secretion systems

    • Identify shared structural features as potential broad-spectrum targets

    • Develop inhibitors that target multiple secretion systems through conserved mechanisms

This research area represents a promising frontier in developing targeted antimicrobial strategies that could minimize selective pressure for resistance while effectively controlling bacterial virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.