Recombinant Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specified tag type requirements, please inform us, and we will prioritize development with the specified tag.
Synonyms
fliP; Z3038; ECs2687; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-245
Protein Length
Full Length of Mature Protein
Species
Escherichia coli O157:H7
Target Names
fliP
Target Protein Sequence
QLPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEKGAQPLREFMLRQ TREADLGLFARLANTGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSFYS
Uniprot No.

Target Background

Function
This protein plays a crucial role in the flagellum-specific transport system.
Database Links

KEGG: ece:Z3038

STRING: 155864.Z3038

Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the flagellar biosynthetic protein FliP and what is its role in bacterial motility?

FliP is a membrane protein component of the flagellar type III secretion system (T3SS) in bacteria such as Salmonella typhimurium. It functions as an essential part of the flagellar export apparatus, specifically within the FliPQR-FlhB complex that forms the export gate. This complex creates a channel through which flagellar subunits transit during flagellar assembly. FliP is encoded within the fliLMNOPQR operon and is absolutely required for flagellation and subsequent bacterial motility . The protein has a predicted molecular mass of approximately 26,755 Da and exists primarily in the membrane fraction, consistent with its hydrophobic properties .

How does FliP interact with other components of the flagellar export apparatus?

FliP functions in concert with FliQ, FliR, and FlhB to form the core export gate complex (FliPQR-FlhB). This complex adopts an energetically favorable closed conformation when inactive, which likely helps maintain the membrane permeability barrier . During flagellar assembly, this gate complex must open to allow flagellar subunits to pass through the narrow channel formed by FliPQR-FlhB into the central channel of the nascent flagellum. FliP specifically recognizes export signals in early flagellar subunits and plays a crucial role in the sequential recognition process that enables proper subunit export .

What structural features characterize the FliP protein?

FliP is characterized by its high hydrophobic residue content, consistent with its localization in the bacterial membrane. One of its notable structural features is the presence of a signal peptide that undergoes cleavage—a relatively rare process for prokaryotic cytoplasmic membrane proteins. This processing results in two forms of FliP: a 25-kDa form (full-length) and a 23-kDa form (cleaved). The cleaved form represents the mature protein after signal peptide removal . The signal peptide cleavage appears to be kinetically important for proper insertion of FliP into the membrane, though experimental evidence shows it is not absolutely required for function .

What are the optimal expression systems for recombinant FliP production?

For recombinant FliP production, researchers have successfully used bacterial expression systems, particularly E. coli strains optimized for membrane protein expression. When designing expression constructs, careful consideration must be given to the signal peptide sequence and its potential cleavage. Expression vectors containing inducible promoters (such as T7 or arabinose-inducible systems) allow controlled expression, which is crucial as membrane protein overexpression can be toxic to host cells.

For experimental manipulations requiring tagged versions of FliP, internal epitope tags (such as HA-tags) have been successfully implemented without disrupting protein function. This approach was validated in studies examining FliP variants including the FliP-M210A mutation . When expressing recombinant FliP, maintaining proper membrane insertion is critical, so expression conditions should be optimized accordingly.

What purification strategies are most effective for isolating functional recombinant FliP?

Purification of membrane proteins like FliP requires specialized approaches. The following methodological steps have proven effective:

  • Membrane fraction isolation: After cell lysis, differential centrifugation separates membrane fractions containing FliP from cytosolic components.

  • Detergent solubilization: Selection of appropriate detergents is critical for maintaining FliP structure and function during extraction from membranes.

  • Affinity chromatography: For tagged recombinant FliP constructs, affinity purification methods can isolate the protein from other membrane components.

  • Size exclusion chromatography: This step helps separate different oligomeric states and ensures homogeneity of the protein preparation.

Throughout the purification process, it's essential to monitor both the full-length (25-kDa) and cleaved (23-kDa) forms of FliP, as both may be present in recombinant preparations depending on the expression system's ability to process the signal peptide .

How can researchers assess the functional integrity of recombinant FliP in experimental systems?

Functional assessment of recombinant FliP can be performed through complementation assays in fliP-null mutant strains. Swimming motility assays on semi-solid agar provide a quantitative measure of flagellar function, where the diameter of swimming halos correlates with functional flagellar assembly . For instance, experiments with FliP-M210A variants demonstrated that mutations affecting the export gate conformation can be quantified by measuring changes in motility halo diameters .

Researchers should consider the following methodological approaches:

  • Complementation assays: Transform fliP-null strains with plasmids encoding wild-type or variant FliP proteins

  • Swimming motility assays: Measure the diameter of swimming halos on semi-solid agar plates

  • Flagellar protein export assays: Quantify the export of early flagellar subunits such as FlgD

  • Membrane localization analysis: Confirm proper insertion of FliP variants into the cytoplasmic membrane

These assays provide comprehensive functional assessment of recombinant FliP proteins and can identify subtle functional differences between variants.

What experimental approaches can identify interaction partners of FliP in the flagellar export apparatus?

To characterize the interaction network of FliP within the flagellar export apparatus, researchers have employed various methodological approaches:

  • Co-immunoprecipitation: Using epitope-tagged FliP variants (such as HA-tagged FliP) to pull down interacting partners

  • Bacterial two-hybrid assays: Identifying direct protein-protein interactions between FliP and other flagellar components

  • Cross-linking experiments: Capturing transient interactions within the membrane environment

  • Cryo-electron microscopy: Visualizing the structural arrangement of FliP within the export gate complex

When performing these experiments, it's critical to maintain the membrane environment or use appropriate detergents to preserve native protein interactions. The FliPQR-FlhB complex structure suggests that these components interact closely to form the export gate, with conformational changes occurring during subunit export .

How do mutations in FliP affect flagellar assembly and bacterial motility?

Site-directed mutagenesis studies have revealed critical functional regions within FliP. For example, the FliP-M210A variant creates an export gate with altered properties that can partially compensate for defects in flagellar subunits . This mutation appears to promote the open conformation of the export gate, enhancing the export of certain subunit variants with improperly positioned export signals.

Researchers investigating structure-function relationships in FliP should:

  • Design targeted mutations based on sequence conservation and structural predictions

  • Assess the impact of mutations on motility through swimming assays

  • Quantify effects on subunit export using secretion assays

  • Examine membrane insertion and complex formation of mutant variants

The functional consequences of FliP mutations provide insights into the mechanism of flagellar assembly and the specific role of FliP within the export apparatus .

What is the significance of signal peptide cleavage in FliP function?

The cleavage of FliP's signal peptide represents an intriguing feature, as this process is relatively uncommon for prokaryotic cytoplasmic membrane proteins. Experimental evidence indicates that while signal peptide cleavage enhances FliP function, it is not absolutely required. Site-directed mutation at the cleavage site resulted in impaired processing, which reduced but did not eliminate complementation of a fliP mutant in swarm plate assays .

These findings suggest that signal peptide cleavage plays an important kinetic role in proper membrane insertion of FliP but is not mechanistically essential for its function once properly inserted in the membrane.

How can researchers study the conformational changes in the FliP-containing export gate?

The FliPQR-FlhB export gate adopts different conformational states during flagellar assembly. Studying these conformational changes presents significant technical challenges but can be approached through several methodologies:

  • Site-specific crosslinking: Introducing cysteine residues at strategic locations allows for disulfide bond formation that can trap specific conformational states

  • Fluorescence resonance energy transfer (FRET): Labeling specific domains can detect conformational changes in real-time

  • Hydrogen-deuterium exchange mass spectrometry: Identifies regions with altered solvent accessibility in different functional states

  • Cryo-electron microscopy: Captures structural snapshots of the export gate in different conformations

Research indicates that the export gate likely transitions between closed and open conformations, with the M210A mutation in FliP promoting the open state . These conformational changes are crucial for understanding the mechanism of flagellar subunit export.

What approaches can identify the sequential recognition of export signals by the FliP-containing export apparatus?

The flagellar export apparatus recognizes two discrete export signals in early flagellar subunits: the gate recognition motif (GRM) and the hydrophobic N-terminal signal. These signals must be optimally positioned relative to each other for efficient export . To investigate this sequential recognition process, researchers can employ the following experimental strategies:

  • Generate subunit variants with altered spacing between export signals

  • Create chimeric proteins with export signals from different subunits

  • Perform dominant-negative inhibition studies with export-defective subunits

  • Analyze the kinetics of subunit export using pulse-chase experiments

How conserved is FliP across bacterial species, and what implications does this have for flagellar research?

FliP is highly conserved across flagellated bacteria, reflecting its essential role in flagellar assembly. Comparative sequence analysis reveals conserved regions that likely correspond to functionally critical domains. When designing experiments with recombinant FliP from different bacterial species, researchers should consider species-specific differences that might affect expression, processing, or function.

The conservation of FliP extends beyond flagellar systems to related type III secretion systems found in bacterial pathogens, where homologous proteins (such as SpaP in virulence-associated secretion systems) perform similar functions. This evolutionary relationship provides opportunities for comparative studies that can illuminate fundamental mechanisms of protein export across different bacterial secretion systems.

How does FliP compare to homologous proteins in other type III secretion systems?

FliP has structural and functional homologs in virulence-associated type III secretion systems, which bacteria use to inject effector proteins into host cells. These homologs (such as SpaP in Salmonella pathogenicity island 1) share sequence similarity and play analogous roles in forming the export apparatus.

Comparing FliP with its homologs provides insights into:

  • Conserved structural features essential for export gate formation

  • Specialized adaptations for different substrate specificities

  • Evolutionary relationships between motility and virulence secretion systems

  • Potential targets for antimicrobial development

The structural and functional similarities between these systems suggest common evolutionary origins and mechanistic principles, while the differences reflect adaptations to distinct biological roles.

What are common challenges in recombinant FliP expression and how can they be addressed?

Researchers working with recombinant FliP often encounter several technical challenges:

ChallengePotential SolutionsRationale
Poor expression levelsOptimize codon usage; use specialized expression strainsMembrane protein expression often requires specialized conditions
Protein aggregationLower induction temperature; reduce expression rateSlower expression allows proper membrane insertion
Signal peptide processing variabilityEngineer constructs with and without signal sequencesDifferent constructs may be needed depending on experimental goals
Difficulty distinguishing full-length and processed formsUse epitope tags at both N and C terminiAllows differentiation between processed and unprocessed forms
Toxicity to host cellsUse tightly controlled inducible promotersPrevents leaky expression that may be toxic

Additionally, when expressing recombinant FliP, researchers should consider the potential impact of epitope tags on protein function. Internal tagging approaches, as demonstrated with HA-tagged FliP variants, can preserve function while enabling detection and purification .

How can researchers overcome challenges in assessing FliP-mediated protein export?

Studying FliP's role in protein export presents several methodological challenges:

  • The membrane localization of FliP makes it difficult to isolate while maintaining native conformation

  • The transient nature of interactions between FliP and export substrates

  • The complexity of the multiprotein export apparatus

To address these challenges, researchers have developed specialized approaches:

  • In vivo export assays using reporter fusion proteins to quantify export efficiency

  • Genetic approaches creating export-stalled intermediates that can trap transient interactions

  • Biochemical reconstitution of the export apparatus in membrane vesicles

  • Dominant-negative variants (like FlgD∆2–5) that stall at specific steps in the export pathway

These methodological approaches have revealed that subunits lacking the hydrophobic N-terminal export signal, but retaining the GRM, stall during export, suggesting sequential recognition of these signals by the export machinery .

What emerging technologies might advance our understanding of FliP function in flagellar assembly?

Several cutting-edge technologies show promise for deepening our understanding of FliP's role in flagellar assembly:

  • Cryo-electron tomography: Enables visualization of the export apparatus in situ within bacterial cells

  • Single-molecule tracking: Allows real-time observation of conformational changes during protein export

  • Microfluidic-based motility assays: Provides high-throughput analysis of motility phenotypes

  • AlphaFold and other AI-based structural prediction tools: Helps model protein-protein interactions within the export apparatus

  • CRISPR-based gene editing: Facilitates precise genetic manipulation to study FliP variants

These technologies will help address fundamental questions about the mechanistic details of how FliP contributes to the export and assembly of flagellar components.

What unresolved questions about FliP function represent important areas for future investigation?

Despite significant advances in understanding FliP function, several key questions remain unresolved:

  • How exactly does FliP recognize and distinguish between different flagellar subunits?

  • What is the precise molecular mechanism of the conformational change between closed and open states of the export gate?

  • How is energy coupled to the export process, and what role does FliP play in energy transduction?

  • What is the exact stoichiometry and spatial arrangement of FliP within the assembled export apparatus?

  • How do post-translational modifications affect FliP function in different bacterial species?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and advanced imaging techniques. The insights gained will not only enhance our understanding of bacterial motility but may also provide new targets for antimicrobial development given the essential role of flagella in bacterial virulence and colonization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.