Recombinant Flavobacterium johnsoniae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Fjoh_1319; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) (Cytophaga johnsonae)
Target Names
mscL
Target Protein Sequence
MGFFSEFKEFAMKGNVVDLAVGVIIGAAFGKIVSSFIEDVITPLLLKPALDAANLSTIEQ LTAFGGVKYGLFLSAVINFIIVAFVLFLIIKAMNHAKKKDVAPPPPPAGPTQEELLTQIR DLLKNK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the mscL protein in Flavobacterium johnsoniae and how does it function?

The Large-conductance mechanosensitive channel (mscL) in Flavobacterium johnsoniae functions as a membrane-embedded valve involved in turgor regulation. Like other bacterial mechanosensitive channels, it responds to mechanical tension in the lipid bilayer, opening when membrane tension increases to prevent cell lysis during osmotic shock conditions .

The mscL protein in Flavobacterium johnsoniae has a structure similar to other bacterial mscL channels, with a cytoplasmic gate formed by a bundle of five amino-terminal helices (S1). When membrane tension is applied, the transmembrane barrel expands and pulls the gate apart through the S1-M1 linker . This gating mechanism allows the channel to regulate the flow of solutes across the membrane in response to mechanical stimuli.

What experimental approaches are most suitable for studying mscL function in Flavobacterium johnsoniae?

For studying mscL function in Flavobacterium johnsoniae, a multi-faceted approach is recommended:

  • Patch-clamp electrophysiology: This is the gold standard for characterizing mechanosensitive channel activity. As demonstrated with other bacterial mscL proteins, calibrated suction pressures can be applied to membrane patches to measure channel opening and conductance properties .

  • Osmotic shock assays: Testing cell survival during hypoosmotic shock conditions in wild-type versus mscL-deficient strains.

  • Heterologous expression systems: Expressing the recombinant Flavobacterium johnsoniae mscL in systems like E. coli spheroplasts for functional studies, similar to approaches used for other mechanosensitive channels .

  • Cryo-electron microscopy: For structural characterization of the protein in different conformational states.

What is the most effective experimental design approach for studying mscL channel gating mechanics?

An effective experimental design for studying mscL channel gating mechanics should incorporate:

  • Site-directed mutagenesis: Based on the methodological approach used by Sukharev et al. (2001), substituting cysteines for residues predicted to be near each other in either the closed or open conformation allows for testing structural models of gating .

  • Crosslinking experiments: Testing whether crosslinking between specific domains (e.g., S1 segments or between S1 and M2) affects channel opening or closing provides insight into the spatial relationships between domains during gating .

  • S1-M1 linker modifications: Systematically altering the length of the S1-M1 linker can reveal its role in force transmission during gating .

  • Multifactorial design approach: Using the principles of experimental design outlined in source , researchers should utilize a structured process with well-defined independent variables (e.g., membrane tension), dependent variables (e.g., channel conductance), and controlled conditions.

Consider using a simultaneous bidirectional framework for data merging analytics as described by Guetterman et al. (2017) to combine quantitative electrophysiological measurements with qualitative structural observations .

How should researchers design experiments to compare mscL function across different bacterial species?

When designing experiments to compare mscL function across different bacterial species:

  • Standardized expression systems: Use a common heterologous expression system (e.g., E. coli lacking endogenous mechanosensitive channels) to compare different mscL homologs under identical conditions.

  • Equivalent measurements: Ensure that patch-clamp protocols, buffer compositions, and membrane tension calculations are standardized across experiments.

  • Mixed methods approach: Employ both quantitative measurements (channel conductance, pressure threshold for activation) and qualitative assessments (adaptation behaviors, ion selectivity profiles) .

  • Controlled environmental variables: Account for the native environmental conditions of each bacterium, as mscL proteins may be adapted to specific ecological niches.

  • Statistical approach: Use ANOVA or similar statistical methods to evaluate significant differences in functional parameters across species.

A statistical experimental design methodology is recommended, where multiple variables can be evaluated simultaneously to account for interactions between factors that might affect channel function .

What controls are essential when performing genetic manipulation studies with Flavobacterium johnsoniae mscL?

When conducting genetic manipulation studies with Flavobacterium johnsoniae mscL, the following controls are essential:

  • Wild-type controls: Unmodified F. johnsoniae strains must be included to establish baseline phenotypes.

  • Complementation controls: If creating knockout mutants, complementation with the wild-type gene should restore function, confirming phenotypic changes are specifically due to mscL disruption .

  • Empty vector controls: When introducing recombinant constructs, empty vector transformants must be analyzed to account for effects of the vector itself.

  • Polar effect controls: Since genetic disruptions can affect downstream genes, construct design should include controls to rule out polar effects, similar to approaches used in other F. johnsoniae genetic studies .

  • Expression verification: Western blotting or RT-PCR to confirm expression levels of recombinant proteins or deletion of target genes.

  • Functional rescue experiments: If manipulating specific domains, demonstrate rescue with the wild-type domain to confirm domain-specific functions.

What expression systems are most effective for producing recombinant Flavobacterium johnsoniae mscL?

Based on current protein expression methodologies and what's known about membrane proteins:

  • E. coli expression systems:

    • BL21(DE3) strains are commonly used for membrane protein expression

    • C41(DE3) and C43(DE3) strains are specially designed for toxic or membrane proteins

    • Expression can be optimized using multivariant analysis approach as described for other recombinant proteins

  • Expression optimization parameters:

    • Temperature: Lower temperatures (16-20°C) often improve membrane protein folding

    • Induction: IPTG concentration between 0.1-0.5 mM typically works well

    • Media composition: Specialized media like Terrific Broth or auto-induction media

    • Expression time: Extended expression periods (24-48 hours) at lower temperatures

  • Fusion tags:

    • His-tags for purification

    • MBP or SUMO tags to enhance solubility

    • Fluorescent protein fusions to monitor expression and localization

The statistical experimental design methodology is recommended for optimization, evaluating multiple variables simultaneously rather than the traditional univariant method .

What are the most effective purification strategies for recombinant Flavobacterium johnsoniae mscL?

Effective purification strategies for recombinant Flavobacterium johnsoniae mscL include:

  • Membrane isolation and solubilization:

    • Cells should be lysed by sonication or French press

    • Membranes isolated by ultracentrifugation

    • Solubilization using appropriate detergents (DDM, LDAO, or UDM are commonly effective)

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Anti-FLAG affinity for FLAG-tagged constructs

  • Size exclusion chromatography:

    • Critical for removing aggregates and ensuring protein homogeneity

    • Useful for assessing oligomeric state

  • Sample quality assessment:

    • SDS-PAGE and western blotting

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to verify secondary structure

  • Detergent exchange:

    • Consider exchanging harsh solubilization detergents for milder ones during purification

    • Exploration of amphipols or nanodiscs for improved stability

Using a multivariant experimental design approach allows optimization of purification conditions while minimizing the number of experiments needed . Monitoring protein activity after each purification step is essential to ensure the recombinant protein maintains its native conformation and function.

How can researchers verify the functional integrity of purified recombinant mscL?

To verify the functional integrity of purified recombinant mscL, researchers should:

  • Electrophysiological assays:

    • Reconstitute purified protein into liposomes or planar lipid bilayers

    • Perform patch-clamp analysis to confirm channel activity and measure conductance

    • Apply calibrated suction pressures to verify mechano-sensitivity

  • Fluorescence-based assays:

    • Reconstitute protein into liposomes loaded with fluorescent dyes

    • Monitor dye release upon application of osmotic shock or membrane stretching

    • Quantify the relationship between tension and channel opening

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure content

    • Size exclusion chromatography to verify oligomeric state

    • Thermal stability assays to assess protein folding

  • Crosslinking experiments:

    • Use crosslinking reagents to capture the protein in closed or open states

    • Analyze crosslinking patterns by mass spectrometry to verify structural integrity

  • Comparative analysis:

    • Compare properties with well-characterized mscL proteins from other bacteria

    • Verify key functional parameters match theoretical predictions from structural models

How can Flavobacterium johnsoniae mscL be used for neuronal mechano-sensitization applications?

Flavobacterium johnsoniae mscL represents a potential tool for neuronal mechano-sensitization based on previous work with bacterial mechanosensitive channels:

  • Heterologous expression in mammalian neurons:

    • Similar to the approach described by Soloperto et al. (2018), the engineered bacterial large-conductance mechanosensitive ion channel can be expressed in mammalian neuronal networks

    • Validate expression through patch-clamp recordings upon application of calibrated suction pressures

  • Lentiviral transduction optimization:

    • Design lentiviral vectors optimized for neuronal expression

    • Use neuron-specific promoters to achieve cell-type specificity

  • In vitro validation protocol:

    • Verify network development in terms of cell survival, number of synaptic puncta, and spontaneous network activity following mscL expression

    • Compare results with control neurons to assess potential cytotoxicity

  • Application design:

    • The pure mechanosensitivity of the engineered mscL, with its genetic modification library, offers a versatile tool for developing mechano-genetic approaches

    • Cell-type-specific mechano-sensitization could enable the development of new non-invasive stimulation approaches for intact brain tissue

  • Parameters to monitor:

    • Channel conductance in response to mechanical stimuli

    • Neural network activity patterns following mechanical stimulation

    • Long-term viability and functionality of mechano-sensitized neurons

What are the primary challenges in studying the relationship between Flavobacterium johnsoniae gliding motility and mscL function?

Studying the relationship between gliding motility and mscL function in Flavobacterium johnsoniae presents several challenges:

  • Mechanistic overlap:

    • The gliding motility apparatus in Flavobacterium johnsoniae shares components with the Type IX Secretion System (T9SS)

    • Determining whether mscL interacts specifically with motility components versus general membrane functions requires careful experimental design

  • Genetic manipulation challenges:

    • Creating clean genetic knockouts requires strategies to avoid polar effects on adjacent genes

    • Complementation experiments need to account for appropriate expression levels

    • The approach used for other F. johnsoniae genes like gldB can serve as a model

  • Phenotype analysis complexity:

    • Distinguishing between direct effects on motility versus indirect effects through osmoregulation

    • Separating motility defects from secretion defects, as demonstrated with gldJ truncation mutants

  • Experimental design considerations:

    • Use of conditional knockouts or inducible expression systems

    • Development of assays that can simultaneously measure turgor pressure and motility

    • Creation of chimeric proteins to identify domain-specific functions

  • Control requirements:

    • Include both motility mutants (e.g., sprB) and secretion-deficient mutants (e.g., porV) as controls

    • Compare results with related species that lack gliding motility but possess mscL

How can researchers utilize experimental design approaches to optimize recombinant Flavobacterium johnsoniae mscL expression levels?

To optimize recombinant Flavobacterium johnsoniae mscL expression levels, researchers should employ a structured experimental design approach:

  • Multivariant statistical experimental design:

    • Unlike the traditional univariant method, this approach evaluates multiple variables simultaneously

    • Allows estimation of statistically significant variables while accounting for interactions between them

    • Enables characterization of experimental error with fewer experiments

  • Key variables to optimize in a factorial design:

    • Temperature (15°C, 20°C, 25°C, 30°C)

    • Inducer concentration (0.1 mM, 0.5 mM, 1.0 mM IPTG)

    • Expression time (4h, 8h, 16h, 24h)

    • Media composition (basic, enriched, auto-induction)

    • Host strain (BL21, C41, C43, Rosetta)

  • Response surface methodology (RSM):

    • After identifying significant factors, use RSM to find optimal conditions

    • Create 3D surface plots to visualize interaction effects between variables

  • Analytical methods for validation:

    • Quantify protein yield by densitometry of SDS-PAGE gels

    • Verify functional integrity through activity assays

    • Assess protein solubility in membrane fractions

  • Implementation example:

    • Design an experimental matrix with 2-3 factors at multiple levels

    • Calculate main effects and interaction effects

    • Identify optimal conditions predicted to maximize protein yield and activity

    • Validate with confirmation runs

This approach has successfully achieved high levels (250 mg/L) of soluble expression of other recombinant proteins in E. coli systems and could be adapted for membrane proteins like mscL.

How does the function of mscL in Flavobacterium johnsoniae compare to its role in other bacterial species?

The function of mscL in Flavobacterium johnsoniae likely shares core mechanistic features with other bacterial species while potentially exhibiting adaptations specific to its ecological niche:

  • Conserved functions across bacteria:

    • Pressure release valve during osmotic shock

    • Regulation of membrane tension

    • Ion channel activity with large conductance

    • Similar gating mechanism involving S1 helices, transmembrane barrel expansion, and the S1-M1 linker

  • Potential Flavobacterium-specific adaptations:

    • May be adapted to the aquatic environments where Flavobacterium species typically live

    • Could have specialized interactions with the unique gliding motility apparatus of F. johnsoniae

    • Possibly integrated with the T9SS that is characteristic of the Bacteroidetes phylum

  • Comparative functional parameters:

    SpeciesGating ThresholdConductanceKey Structural Features
    M. tuberculosis5-10 mN/m~3 nSWell-characterized crystal structure
    E. coli8-12 mN/m~3 nSExtensively studied genetics and physiology
    F. johnsoniaeRequires determinationRequires determinationPotential adaptations for gliding motility environment
  • Evolutionary context:

    • mscL is considered ubiquitous in bacteria, suggesting fundamental importance

    • The sequence conservation across species indicates strong selective pressure

    • Functional adaptations may reflect the specific membrane characteristics of different bacterial phyla

What novel applications could emerge from further research on Flavobacterium johnsoniae mscL?

Further research on Flavobacterium johnsoniae mscL could lead to several innovative applications:

  • Bioengineered mechanosensitive systems:

    • Development of novel mechano-genetic tools for non-invasive stimulation of specific cell types

    • Creation of synthetic cellular systems with programmed responses to mechanical stimuli

    • Engineering bacteria with modified mscL channels that respond to specific mechanical cues

  • Neuroscience applications:

    • Remote stimulation techniques for neuronal tissues using mechanical stimuli

    • Cell-type-specific mechano-sensitization for intact brain tissue stimulation

    • Tools for studying mechanotransduction in neural development and function

  • Biotechnology platforms:

    • Biosensors for detecting membrane stress or environmental pressure changes

    • Controlled release systems triggered by mechanical stimuli

    • Bacterial chassis with engineered mechanosensitive properties for bioproduction

  • Insights into bacterial physiology:

    • Better understanding of how gliding bacteria coordinate motility and osmoregulation

    • Potential targets for antimicrobial development specifically against Bacteroidetes

    • Models for understanding membrane protein evolution and specialization

  • Structural biology advances:

    • Comparative structural studies may reveal unique adaptations in the Flavobacterium mscL channel

    • Insights into protein mechanics and force transduction across membranes

    • Novel frameworks for designing synthetic mechanosensitive proteins

What methodological approaches should be considered when investigating potential interactions between mscL and the gliding motility apparatus in Flavobacterium johnsoniae?

Investigating potential interactions between mscL and the gliding motility apparatus requires sophisticated methodological approaches:

  • Genetic interaction mapping:

    • Create double mutants combining mscL mutations with mutations in various gliding motility genes (gldA, gldB, gldF, sprB)

    • Perform synthetic genetic array analysis to identify genetic relationships

    • Use complementation studies to verify interactions

  • Localization studies:

    • Fluorescently tag mscL and gliding motility proteins to examine co-localization

    • Use super-resolution microscopy to precisely map spatial relationships

    • Track dynamic changes in localization during gliding motility and osmotic challenges

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation of mscL with gliding motility components

    • Cross-linking mass spectrometry to identify direct interactions

    • Bacterial two-hybrid or split-GFP approaches to verify interactions in vivo

  • Functional coupling experiments:

    • Measure mscL activity during active gliding versus stationary phases

    • Determine if osmotic challenges affect gliding motility parameters

    • Investigate if mechanosensitive channel blockers affect motility

  • Structural biology approaches:

    • Cryo-electron tomography to visualize the spatial relationship between mscL and the cell surface filaments involved in gliding

    • Similar to the approach used to identify tufts of cell surface filaments in F. johnsoniae

  • Bidirectional experimental framework:

    • Use an exploratory bidirectional framework for data merging analytics

    • Combine qualitative observations with quantitative measurements

    • Integrate findings through joint displays that juxtapose quantitative and qualitative results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.