Recombinant Flavobacterium johnsoniae NADH-quinone oxidoreductase subunit K (nuoK)

What is Flavobacterium johnsoniae NADH-quinone oxidoreductase subunit K (nuoK)?

NADH-quinone oxidoreductase subunit K (nuoK) is a 106-amino acid membrane protein component of the NADH dehydrogenase I (NDH-1) complex in Flavobacterium johnsoniae. As indicated in product information, this protein functions as part of the respiratory chain electron transport system . The amino acid sequence of the full-length protein is: MGNILNQIGIENYIFLSVVLFCIGVFGVLYRRNSIIVFMSIEIMLNAVNLLFVAFSTYHQDAQGQVFVFFSMAVAAAEVAVGLAILVSIFRNIGSISIDNLKNLKG . Being a membrane protein with hydrophobic domains, nuoK likely participates in proton translocation during energy metabolism processes.

How does gene expression of nuoK differ from typical bacterial gene expression?

The expression of nuoK in F. johnsoniae exhibits distinctive characteristics compared to most bacteria due to the unique translation mechanisms in the Bacteroidetes phylum. While most bacteria utilize Shine-Dalgarno (SD) sequences for translation initiation, F. johnsoniae and other Bacteroidetes naturally lack these sequences in their mRNA, despite their ribosomes retaining the conserved anti-SD sequence . Translation initiation of genes like nuoK is instead regulated by mRNA secondary structure and specific nucleotides upstream of the start codon, particularly adenine at position -3, which resembles the Kozak sequence found in eukaryotes . Additionally, the trinucleotide AUG is underrepresented near start codons in Bacteroidetes, potentially compensating for the absence of SD sequences .

What are the optimal storage and handling conditions for recombinant nuoK protein?

For optimal results when working with recombinant nuoK, researchers should store the protein at -20°C/-80°C upon receipt, with aliquoting recommended for multiple uses to avoid repeated freeze-thaw cycles which can compromise protein integrity . Working aliquots can be maintained at 4°C for up to one week . The lyophilized protein is typically provided in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom, and reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage after reconstitution, adding glycerol to a final concentration of 5-50% is recommended before aliquoting and freezing .

What expression systems are suitable for producing recombinant F. johnsoniae nuoK?

Based on available product information, recombinant full-length F. johnsoniae nuoK has been successfully expressed in E. coli with an N-terminal His tag . This suggests that standard bacterial expression systems using E. coli are suitable production platforms for this membrane protein. When designing expression constructs, researchers should account for the hydrophobic nature of nuoK as a membrane protein, which may require optimization of conditions to ensure proper folding and solubilization. Expression vectors that allow tight regulation of protein expression may be beneficial as overexpression of membrane proteins can often be toxic to host cells.

What methodologies are recommended for studying nuoK function in respiratory processes?

To investigate nuoK's role in respiratory function, researchers might employ several complementary approaches:

• Gene deletion studies: Creating in-frame deletions of the nuoK gene following methodologies similar to those used for other F. johnsoniae genes in surface colonization studies .

• Oxygen consumption assays: Measuring changes in respiratory capacity in wild-type versus nuoK mutant strains.

• Membrane potential measurements: Assessing the impact of nuoK modifications on proton translocation and membrane potential maintenance.

• Complementation assays: Confirming phenotypes by reintroducing functional nuoK on plasmids to restore wild-type function .

• Protein-protein interaction studies: Identifying binding partners of nuoK within the respiratory complex and other cellular components.

These approaches could provide comprehensive insights into how nuoK contributes to energy generation in F. johnsoniae.

How can researchers validate nuoK protein quality and activity?

Validation of recombinant nuoK quality and activity is essential for reliable experimental outcomes. Recommended validation approaches include:

This multi-parameter validation approach ensures that experimental observations can be reliably attributed to functional nuoK protein.

How might nuoK be involved in F. johnsoniae's surface colonization and biofilm formation?

While direct evidence linking nuoK to surface colonization is not present in the search results, there are compelling reasons to investigate this connection. F. johnsoniae is known for its ability to colonize surfaces and form biofilms, with recent research identifying multiple genes involved in these processes through transposon mutagenesis screens . Since nuoK functions in energy metabolism as part of the respiratory chain, it could influence colonization and biofilm formation through several mechanisms:

• Providing energy for cellular motility systems required for surface exploration

• Supporting metabolic activities necessary for adhesion protein synthesis

• Contributing to maintenance of proton motive force that may be linked to adhesion mechanisms

• Affecting cellular responses to environmental conditions on surfaces

Researchers investigating this connection could design experiments similar to those described for other F. johnsoniae genes, including quantification of surface attachment, biofilm formation, and complementation studies with plasmid-borne copies of nuoK .

What is the relationship between nuoK and the gliding motility mechanism of F. johnsoniae?

F. johnsoniae exhibits a distinctive gliding motility that allows rapid movement over surfaces . While nuoK has not been directly identified among the canonical motility genes (such as the gld genes) in the available search results, as a component of energy metabolism, it may play an indirect but significant role in motility:

• The energy provided through respiratory processes where nuoK functions could be critical for powering the gliding motility apparatus

• Changes in membrane potential, which nuoK may influence, could affect proton-driven motors or other components of the motility system

• Metabolic status signaling via the respiratory chain might regulate motility in response to environmental conditions

To investigate potential connections between nuoK and motility, researchers could generate nuoK deletion mutants and assess their motility phenotypes on surfaces, complementing these observations with energy metabolism measurements to establish mechanistic links.

How does nuoK contribute to F. johnsoniae's adaptation to different environmental conditions?

As a respiratory chain component, nuoK likely plays a role in F. johnsoniae's adaptation to varying environmental conditions. While specific studies on nuoK's role in environmental adaptation are not detailed in the search results, several hypotheses can be formulated:

• nuoK may contribute to energy conservation under nutrient-limited conditions

• Its function might be modulated under different oxygen tensions, allowing respiratory flexibility

• The protein could participate in redox balancing when F. johnsoniae colonizes different surfaces

• Expression or activity of nuoK might change when transitioning between planktonic and biofilm lifestyles

Research approaches to explore these hypotheses could include comparative transcriptomics/proteomics of nuoK expression under different conditions and phenotypic characterization of nuoK mutants across environmental gradients.

How should researchers approach contradictory results when studying nuoK function?

When encountering contradictory results in nuoK studies, researchers should recognize that negative or contradicting results are not necessarily due to experimental inadequacies . A systematic approach includes:

• Verify experimental conditions: Ensure consistency in protocols, reagents, and controls across experiments

• Consider biological variability: F. johnsoniae strains may exhibit genetic or phenotypic variations affecting nuoK function

• Examine experimental parameters: Minor differences in temperature, media composition, or growth phase can affect outcomes

• Perform repeat studies: Replicate experiments with larger sample sizes to assess reproducibility

• Document and publish negative results: Contradictory findings contribute valuable information to the field and should be published in appropriate journals

Research has shown that even well-designed studies can produce contradictory results, with one analysis finding that 16% of highly-cited trials published in high-impact journals produced contradictory results .

What statistical approaches are recommended for analyzing variable results in nuoK functional studies?

When analyzing variable results in nuoK studies, appropriate statistical approaches are essential:

What journals accept publication of contradictory results in nuoK or related studies?

Researchers encountering contradictory results when studying nuoK should be aware that several journals specifically welcome such findings. The International Committee of Medical Journal Editors (ICMJE) recommends that journal editors consider publishing contradictory studies if they are scientifically valid . Specific journals dedicated to publishing contradictory or negative results include:

• Journal of Negative Results in Biomedicine

• Journal of Negative Results

• Journal of Contradicting Results in Science

• The All Results Journal

• Journal of Negative Pharmaceutical Results

• International Journal of Negative and Null Results

• Journal of Errology

Additionally, journals such as PLoS One, F1000 Research, and Scientific Reports are open to publishing contradictory findings . Publishing such results prevents unnecessary duplication of research efforts and contributes to a more complete scientific understanding.

How does research on nuoK connect with studies of F. johnsoniae's unique translation mechanisms?

Research on nuoK can be integrated with broader studies of F. johnsoniae's distinctive translation initiation mechanisms. As members of the Bacteroidetes phylum, F. johnsoniae cells lack traditional Shine-Dalgarno sequences for translation initiation despite retaining the conserved anti-SD sequence in their ribosomes . This raises interesting questions about nuoK expression:

• How is translation of nuoK mRNA regulated without SD sequences?

• Does the Kozak-like sequence with adenine at position -3 influence nuoK expression efficiency?

• How does mRNA secondary structure affect nuoK translation?

• Are there differences in translation efficiency between nuoK and its homologs in bacteria that use SD-dependent translation?

Investigating these questions would connect energy metabolism (via nuoK) with fundamental mechanisms of gene expression in this bacterial phylum and could reveal regulatory adaptations specific to Bacteroidetes.

What techniques are suitable for studying nuoK in microbial community contexts?

To study nuoK function in microbial community contexts, researchers could employ several techniques:

• Community-based transposon screens: Similar to the INSeq approach used in F. johnsoniae surface colonization studies to identify genes important in communities

• Co-culture experiments: Examining nuoK expression when F. johnsoniae interacts with other bacteria, such as in the THOR model community described in the literature

• Comparative transcriptomics: Analyzing nuoK expression changes in pure culture versus community settings

• Mutant fitness assays: Comparing fitness of nuoK mutants versus wild-type in community settings

• In situ expression analysis: Developing techniques to monitor nuoK expression in natural communities

Research has shown that F. johnsoniae behaviors and gene expression can differ significantly between pure culture and community contexts , suggesting nuoK function may similarly be modulated by interspecies interactions.