Recombinant Flavobacterium psychrophilum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; FP1065; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)
Target Names
mscL
Target Protein Sequence
MGFFADFKASLMKGDVLSLATAVVIGGAFGKIVGSAVDDIIMPIVGVLTGGVDFTTKFIA LNGQSYADLAAAKTAGAACLTYGNLVQAIINFIIISFFIFVVLRAAEKAKKKEEAAPTAP AGPSQEELLTQIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links

KEGG: fps:FP1065

STRING: 402612.FP1065

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing recombinant F. psychrophilum mscL protein?

Current research indicates that recombinant F. psychrophilum mscL protein is typically expressed using E. coli as the host organism . The optimal expression system includes:

ParameterRecommendation
Expression HostE. coli (commonly BL21(DE3) or specialized strains for membrane proteins)
VectorpET-based systems with N-terminal His-tag
InductionIPTG at lower concentrations (0.1-0.5 mM)
TemperatureLower temperatures (16-20°C) to facilitate proper folding
MediaEnriched media (e.g., Terrific Broth) supplemented with glycerol
DurationExtended expression (16-24 hours)

Since mscL is a membrane protein, specialized approaches may be required to enhance expression and solubility. The recombinant protein is typically purified as a lyophilized powder and requires proper reconstitution in an appropriate buffer system, often containing trehalose as a stabilizing agent .

Purification Protocol:

  • Cell Lysis:

    • Resuspend E. coli cells expressing His-tagged mscL in Tris/PBS-based buffer (pH 8.0)

    • Lyse cells using sonication or French press

    • Add mild detergents to solubilize membrane proteins

  • Affinity Chromatography:

    • Purify using Ni-NTA resin

    • Wash with increasing imidazole concentrations

    • Elute with high imidazole buffer containing appropriate detergent

  • Size Exclusion Chromatography:

    • Further purify using gel filtration to remove aggregates

    • Maintain detergent above critical micelle concentration

    • Collect fractions and analyze by SDS-PAGE

  • Quality Assessment:

    • Verify purity via SDS-PAGE (protein should appear >90% pure)

    • Confirm identity using western blotting and/or mass spectrometry

    • Assess homogeneity using dynamic light scattering

Structural Characterization Methods:

MethodInformation ObtainedConsiderations
Circular DichroismSecondary structure analysisRequires detergent optimization
FTIR SpectroscopySecondary structure in membrane environmentCan be performed in reconstituted lipid systems
Cross-linking StudiesOligomeric state assessmentUse bifunctional reagents to capture native state
Cryo-electron MicroscopyHigh-resolution structural dataRequires optimization for membrane proteins
Molecular DynamicsDynamic behavior predictionsBased on homology models or experimental structures

For recombinant F. psychrophilum mscL, researchers frequently use trehalose (6%) in the storage buffer to maintain protein stability, and recommend reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

What experimental designs are recommended for investigating the role of mscL in F. psychrophilum virulence?

Investigating the contribution of mscL to F. psychrophilum virulence requires carefully designed experiments that address both in vitro and in vivo aspects of pathogenesis:

In Vitro Approaches:

  • Gene Knockout Studies:

    • Create clean deletion mutants of mscL using homologous recombination or CRISPR-Cas9

    • Construct complementation strains to verify phenotype specificity

    • Use suicide vectors like pYT313 for gene deletion as demonstrated for other virulence factors

  • Comparative Growth Analysis:

    • Assess growth rates of wild-type, ΔmscL mutant, and complemented strains under:

      • Osmotic stress conditions

      • Temperature fluctuations

      • Nutrient limitation

      • Host-mimicking environments

  • Transcriptional Analysis:

    • Employ qRT-PCR or RNA-seq to examine mscL expression during:

      • Different growth phases

      • Exposure to host factors

      • Stress conditions relevant to infection

In Vivo Approaches:

  • Infection Model Design:

    • Use rainbow trout (Oncorhynchus mykiss) as the primary host species

    • Compare fry vs. fingerling susceptibility

    • Consider resistant and susceptible genetic backgrounds

    • Control water temperature at 10°C (optimal for disease development)

  • Inoculation Methods:

    • Intraperitoneal injection (2.6×10⁴ CFU) for controlled dose delivery

    • Immersion challenge with pre-treatment (H₂O₂ at 150 mg/L) to enhance infection

    • Co-habitation models to assess transmission dynamics

  • Outcome Assessment:

    • Monitor mortality rates and clinical signs

    • Quantify bacterial loads in tissues (spleen, kidney, brain) using qPCR

    • Examine tissue samples via histopathology with H&E staining

    • Use FISH to localize bacteria within tissues

    • Measure host immune responses through transcriptional analysis

This experimental approach has been successfully applied to identify other virulence factors in F. psychrophilum, such as the HfpR and BfpR heme/iron transport systems .

How do researchers address data contradictions in F. psychrophilum mscL functional studies?

Researchers may encounter contradictory results when studying F. psychrophilum mscL function, similar to challenges reported with other F. psychrophilum proteins. To address these contradictions:

Methodological Consistency Assessment:

  • Protocol standardization: Document precise procedures for protein expression, purification, and functional assays

  • Batch effects monitoring: Include internal controls to identify variations between experimental batches

  • Environmental variable control: Strictly regulate temperature, pH, and ionic conditions

Reproducibility Enhancement Strategies:

  • Multiple independent replicates: Perform at least three biological replicates with different protein preparations

  • Cross-laboratory validation: Collaborate with other research groups to verify findings

  • Method triangulation: Apply multiple complementary techniques to test the same hypothesis

Case Study: Lessons from F. psychrophilum Vaccine Development:

A study attempting to validate a recombinant F. psychrophilum gliding motility protein (GldN) as a vaccine candidate reported contradictory protection results across multiple trials . Key factors identified for resolving such contradictions included:

Data Integration Framework:

When contradictory results arise, researchers should:

  • Create a comprehensive data matrix comparing all experimental variables

  • Identify patterns in successful versus unsuccessful experiments

  • Develop testable hypotheses to explain contradictions

  • Design targeted experiments to resolve specific inconsistencies

Challenges:

  • Membrane Protein Stability:

    • mscL naturally resides in bacterial membranes and may denature during purification

    • The psychrophilic nature of F. psychrophilum adds temperature sensitivity considerations

    • Detergent selection can significantly impact protein folding and function

  • Reconstitution Difficulties:

    • Achieving proper orientation in artificial membranes

    • Maintaining functional oligomeric state (likely pentameric based on homologous proteins)

    • Creating appropriate membrane tension for channel activation

  • Function Verification:

    • Developing suitable assays for channel activity measurement

    • Distinguishing between specific channel function and non-specific membrane effects

    • Recreating physiologically relevant conditions for a psychrophilic bacterium

Solutions and Methodological Approaches:

ChallengeSolutionMethodological Details
Protein StabilityOptimize purification conditionsUse 6% trehalose in storage buffer; maintain at 4°C for short-term work
Cold-adapted expressionExpress at lower temperatures (15-18°C) to promote proper folding
Detergent screeningTest multiple detergents (DDM, LMNG, etc.) for optimal stability
ReconstitutionLipid composition optimizationInclude bacterial phospholipids and test psychrophile-specific lipid mixtures
Controlled incorporationUse gradual detergent removal via dialysis or Bio-Beads
Size controlExtrude liposomes through defined filters for uniform size distribution
Functional AssaysDye release assaysEncapsulate fluorescent dyes in liposomes for channel activity monitoring
Patch-clamp electrophysiologyMeasure single-channel conductance in reconstituted systems
Osmotic shock survivalTest complementation of mscL-deficient bacterial strains

Recent advances with mechanosensitive channels from other psychrophilic bacteria (such as Psychrobacter sp.) provide valuable methodological frameworks that can be adapted for F. psychrophilum mscL .

How can comparative genomics inform research on F. psychrophilum mscL?

Comparative genomics approaches offer powerful insights for F. psychrophilum mscL research:

Strain Variation Analysis:

The F. psychrophilum pan-genome contains approximately 3,040 genes, with 2,228 genes in the core genome of virulent strains . Comparative analysis can reveal:

  • Conservation level: Determine if mscL is part of the core genome across all strains

  • Sequence variations: Identify strain-specific polymorphisms that might affect function

  • Genetic context: Examine flanking regions for potential co-regulated genes

  • Correlation with virulence: Compare mscL sequences between high and low virulence strains (such as strain Dubois vs. strain 99/10A)

Cross-Species Comparison:

Analyzing mscL across the Flavobacteriaceae family and other bacterial groups:

  • Evolutionary conservation: Identify universally conserved residues critical for function

  • Psychrophilic adaptations: Detect amino acid substitutions unique to cold-adapted species

  • Functional diversity: Discover potential specialized roles in different environmental niches

Methodological Implementation:

ApproachTools/MethodsExpected Outcomes
Whole Genome ComparisonBLAST, MAUVE, Progressive MauveIdentification of syntenic regions and genomic context
Protein Sequence AnalysisMUSCLE, CLUSTAL, HMMERMultiple sequence alignments, conserved motifs
Phylogenetic AnalysisRAxML, MrBayes, IQ-TREEEvolutionary relationships, selection pressure
Structural PredictionAlphaFold, I-TASSER, Swiss-Model3D structural models, functional domain prediction
Pan-genome AnalysisRoary, PanOCT, PGAPCore vs. accessory gene classification

Research Application Examples:

  • A large-scale analysis of F. psychrophilum genetic diversity identified numerous sequence types and clonal complexes across North America . Similar approaches could reveal mscL variants associated with:

    • Geographic distribution

    • Host specificity

    • Disease manifestation (BCWD vs. RTFS)

    • Environmental persistence

  • Comparative genomics helped identify promising vaccine candidates for F. psychrophilum using reverse vaccinology . This approach could also evaluate mscL as a potential vaccine target by assessing:

    • Antigenicity prediction

    • Surface exposure

    • Conservation across pathogenic strains

    • Absence in commensal or beneficial bacteria

What are the advanced techniques for studying mscL protein interactions with host immune factors?

Understanding interactions between F. psychrophilum mscL and host immune factors requires sophisticated experimental approaches:

Host-Pathogen Protein Interaction Assays:

  • Pull-down assays: Use purified His-tagged mscL protein to identify binding partners from fish tissue lysates

  • Surface plasmon resonance: Measure binding kinetics between mscL and candidate host proteins

  • Cross-linking coupled with mass spectrometry: Identify interaction interfaces in complex biological samples

  • Yeast two-hybrid screening: Discover potential protein-protein interactions using fish cDNA libraries

Immunological Response Assessment:

Rainbow trout exhibit complex immune responses to F. psychrophilum infection, including upregulation of antimicrobial peptides, complement, and various enzymes and chemokines . To study mscL's role:

  • Comparative transcriptomics: Compare host immune gene expression between wild-type and ΔmscL mutant infections

  • Cytokine profiling: Measure pro-inflammatory (IL-1) and anti-inflammatory (IL-10) cytokine responses

  • Antibody development: Generate specific antibodies against mscL for immunolocalization studies

  • Phagocytosis assays: Examine if mscL affects bacterial uptake and survival in fish phagocytes

Advanced Microscopy Techniques:

TechniqueApplicationKey Advantages
Confocal MicroscopyLocalization of fluorescently labeled mscL during infectionHigh resolution, 3D imaging capabilities
FRET MicroscopyDetecting molecular interactions in real-timeDirect measurement of protein-protein proximity
Super-resolution MicroscopyNanoscale visualization of mscL distributionOvercomes diffraction limit for detailed imaging
Correlative Light-Electron MicroscopyCombining functional and ultrastructural informationLinks molecular function to cellular structure

In Vitro Models of Host-Pathogen Interface:

  • Primary cell cultures: Isolated gill epithelial cells or macrophages from rainbow trout

  • Tissue explants: Maintained gill arches in perfusion systems

  • Microfluidic organ-on-chip: Engineered systems mimicking fish tissue microenvironments

  • 3D cell culture models: Recreating complex tissue architecture for infection studies

Research on F. psychrophilum adhesion to rainbow trout tissues has demonstrated strain-specific variations in virulence , suggesting that membrane proteins like mscL may play important roles in host-pathogen interactions.

How can researchers design experiments to assess the potential of F. psychrophilum mscL as an antimicrobial target?

Evaluating F. psychrophilum mscL as an antimicrobial target requires a multifaceted experimental approach:

Target Validation Studies:

  • Essentiality assessment: Determine if mscL is required for bacterial survival and virulence

  • Growth inhibition studies: Measure effects of gene knockdown or inactivation on bacterial fitness

  • In vivo significance: Evaluate the impact of mscL disruption on infection progression in fish models

  • Resistance potential: Assess the likelihood of resistance development through mutation

High-throughput Screening Approaches:

  • Compound libraries: Screen diverse chemical collections for mscL inhibitors or activators

  • Assay development: Create robust screening systems based on:

    • Channel activity (fluorescence-based ion flux assays)

    • Bacterial growth inhibition

    • Protein-compound binding (thermal shift assays)

    • Structure-based virtual screening

Rational Drug Design Strategy:

PhaseApproachMethodology
Structure ElucidationX-ray crystallography or Cryo-EMGenerate high-resolution structural data
Binding Site IdentificationComputational pocket analysisIdentify druggable sites
Fragment ScreeningNMR or crystallography-based methodsIdentify chemical starting points
Lead OptimizationMedicinal chemistry and SARImprove potency and selectivity
Membrane Interaction StudiesBiophysical techniquesEnsure compound access to target

Delivery System Development:

F. psychrophilum primarily affects fish in aquaculture settings, requiring specialized delivery approaches:

  • Water-based delivery: Formulations suitable for aquatic environments

  • Feed incorporation: Bioavailable compounds for oral administration

  • Nano-encapsulation: Protected delivery to ensure stability in water

  • Targeted delivery: Systems that specifically accumulate in infected tissues

Efficacy Testing Framework:

  • In vitro efficacy:

    • Minimum inhibitory concentration determination

    • Time-kill assays

    • Biofilm inhibition assessment

    • Resistance development monitoring

  • Ex vivo models:

    • Gill tissue explant infection models

    • Organ bath systems with perfusion

  • In vivo evaluation:

    • Controlled infection studies in rainbow trout

    • Dose optimization for aquatic delivery

    • Safety assessment in target species

    • Efficacy comparison with current treatments

This approach builds on successful research strategies that have identified other promising F. psychrophilum targets, such as the heme/iron transport systems HfpR and BfpR that have been validated as virulence determinants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.