Recombinant Flavobacterium psychrophilum NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
nuoA; FP2232; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)
Target Names
nuoA
Target Protein Sequence
MQSNQLDYLPIFMQMGLAVGFVVLTIIGSSFLGPKRSSVNKDKNFESGIESIGNARVPFS VKYFLVAILFVLFDVEVIFLYPWAINFQELGMQGMIKMVIFMSLLLVGFFYIIKKKALEW D
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this organism, the primary electron acceptor is believed to be a menaquinone. This process couples the redox reaction to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.
Database Links

KEGG: fps:FP2232

STRING: 402612.FP2232

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of NADH-quinone oxidoreductase subunit A in F. psychrophilum pathogenicity?

NADH-quinone oxidoreductase subunit A (nuoA) functions as a critical component of the respiratory chain Complex I in Flavobacterium psychrophilum. This protein contributes to energy metabolism by participating in electron transport and proton translocation across the bacterial membrane. The role of nuoA in pathogenicity stems from its contribution to bacterial energy production under the variable environmental conditions encountered during host infection.

Based on research with F. psychrophilum, respiratory chain components like nuoA may contribute to virulence by:

  • Enabling bacterial survival during temperature fluctuations characteristic of coldwater disease

  • Supporting energy requirements during biofilm formation

  • Maintaining cellular functions during host immune responses

  • Potentially contributing to stress tolerance mechanisms

Research suggests F. psychrophilum exhibits differential gene expression between free-living and biofilm states, which may include respiratory chain components necessary for persistence in aquaculture settings .

How conserved is nuoA across different F. psychrophilum strains and types?

The nuoA gene appears to be relatively conserved among F. psychrophilum strains, although genomic analyses have revealed considerable diversity in this pathogen. While specific data on nuoA conservation is not directly presented in the available research, genomic studies of F. psychrophilum have identified:

  • Four distinct genomic Types (0-3) with varying degrees of genetic relatedness

  • Type-specific genes associated with polysaccharide biosynthesis that contribute to serological diversity

  • Evidence of gene exchange by recombination at certain loci

This genomic plasticity suggests that while core metabolic genes like nuoA may be conserved, strain-specific variations could exist, potentially affecting protein function, expression levels, or regulation under different environmental conditions.

Table 1: Predicted Conservation of Respiratory Chain Components Across F. psychrophilum Types

ProteinType-0Type-1Type-2Type-3Function
NuoAHighHighHighHighNADH dehydrogenase subunit
NuoBHighHighHighHighNADH dehydrogenase subunit
NuoCDHighHighHighHighNADH dehydrogenase subunit
NuoEMediumMediumMediumMediumNADH dehydrogenase subunit
NuoFMediumMediumMediumMediumNADH dehydrogenase subunit

Note: Conservation levels are predicted based on general bacterial respiratory chain components and genomic analysis patterns of F. psychrophilum strains

What are the optimal expression systems for producing recombinant F. psychrophilum nuoA protein?

When expressing recombinant F. psychrophilum nuoA, researchers should consider several factors that influence successful protein production:

Table 2: Recommended Expression Conditions for Recombinant F. psychrophilum nuoA

ParameterStandard ProtocolOptimized for nuoARationale
Expression hostE. coli BL21(DE3)Arctic Express RILEnhanced expression at low temperatures
Induction temperature37°C15-18°CMatches pathogen's natural growth temperature
Induction duration3-4 hours16-24 hoursCompensates for slower growth at low temperature
IPTG concentration1.0 mM0.1-0.5 mMPrevents toxic accumulation at extended induction
Media supplementsStandard LBLB + 5% glycerolStabilizes protein during expression

What purification strategies are most effective for recombinant F. psychrophilum nuoA?

Purifying recombinant nuoA requires specialized approaches due to its membrane-associated nature. A multi-step purification strategy is recommended:

  • Initial extraction:

    • Use mild detergents (DDM, LDAO, or Triton X-100) to solubilize membrane fractions

    • Maintain low temperatures (4°C) throughout the purification process

    • Consider native vs. denaturing conditions based on downstream applications

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) with His-tagged constructs

    • Include detergent at concentrations above critical micelle concentration in all buffers

    • Gradual elution to separate nuoA from contaminating proteins

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric nuoA from aggregates

    • Ion exchange chromatography at pH values distant from nuoA's theoretical pI

  • Quality assessment:

    • SDS-PAGE analysis for purity evaluation

    • Western blotting for identity confirmation

    • Circular dichroism for secondary structure assessment

For functional studies, maintaining the native conformation is crucial. Consider reconstitution into nanodiscs or liposomes for activity assays if studying electron transport functions.

How can researchers effectively measure the activity of recombinant nuoA in the context of F. psychrophilum respiratory chain?

Measuring nuoA activity presents challenges as it functions as part of the larger Complex I. Effective approaches include:

  • Reconstitution experiments:

    • Co-express multiple nuo subunits to reconstitute partial or complete Complex I

    • Reconstitute purified nuoA with other subunits in artificial membrane systems

    • Measure NADH oxidation rates spectrophotometrically at 340 nm

  • Electron transport assays:

    • Assess electron transfer using artificial electron acceptors (menadione, ubiquinone analogs)

    • Measure membrane potential generation using potential-sensitive fluorescent dyes

    • Compare activity at different temperatures (4-25°C) to evaluate temperature-dependent function

  • In vivo complementation:

    • Introduce recombinant nuoA into nuoA-deficient bacterial strains

    • Evaluate restoration of respiratory chain function

    • Measure growth rates and survival under various conditions

Table 3: Recommended Activity Assays for F. psychrophilum nuoA

Assay TypeMeasurementTechnical ConsiderationsTemperature Range
NADH oxidationAbsorbance decrease at 340 nmRequires additional subunits4-25°C
Electron transferReduction of artificial acceptorsCan be monitored spectrophotometrically4-25°C
Membrane potentialFluorescence of potential-sensitive dyesRequires membrane reconstitution4-25°C
Oxygen consumptionClark-type electrode measurementsNeeds complete respiratory chain4-25°C

What approaches can be used to investigate nuoA's role in F. psychrophilum virulence and host adaptation?

Investigating nuoA's contribution to F. psychrophilum virulence requires multi-faceted approaches:

  • Gene knockout/knockdown studies:

    • Create targeted nuoA mutants using CRISPR-Cas or homologous recombination

    • Compare growth curves between wild-type and mutant strains at various temperatures

    • Evaluate biofilm formation capacity, which is linked to virulence in F. psychrophilum

  • In vitro infection models:

    • Use fish cell lines like CHSE-214 (chinook salmon embryo cells) for cytotoxicity assays

    • Compare wild-type vs. nuoA-modified strains using LDH cytotoxicity detection assays

    • Quantify bacterial adherence, invasion, and cytotoxic effects

  • Transcriptomics approaches:

    • Measure nuoA expression levels under various environmental conditions

    • Compare expression in planktonic vs. biofilm states

    • Evaluate expression during fish cell infection

  • In vivo virulence assessment:

    • Challenge rainbow trout or other susceptible fish with wild-type and nuoA-modified strains

    • Monitor mortality rates, bacterial loads, and tissue distribution

    • Evaluate host immune responses to infection

Research has demonstrated that F. psychrophilum biofilms exhibit different virulence characteristics compared to planktonic cells , suggesting that respiratory chain components like nuoA may have differential expression or function in these distinct growth states.

How should researchers interpret differences in nuoA expression between F. psychrophilum strains with varying virulence profiles?

When analyzing nuoA expression differences between strains, consider these methodological approaches:

  • Normalization strategies:

    • Select stable reference genes unaffected by experimental conditions

    • Use multiple reference genes to improve reliability

    • Apply geometric averaging of normalization factors

  • Statistical analysis:

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

    • Use corrected p-values for multiple comparisons

    • Consider biological significance alongside statistical significance

  • Correlation with phenotypic data:

    • Link expression changes to measurable virulence phenotypes

    • Correlate with cytotoxicity assay results

    • Compare with strain-specific mortality rates in fish challenge models

  • Contextual interpretation:

    • Consider expression in broader context of respiratory chain components

    • Evaluate co-expression patterns with other virulence factors

    • Assess expression in relation to environmental conditions (temperature, oxygen, nutrients)

Research shows that F. psychrophilum isolates exhibit varying levels of cytotoxicity and virulence in fish models , suggesting that metabolic components like nuoA may contribute differentially to pathogenicity across strains.

What are the best approaches for analyzing sequence variations in nuoA across different F. psychrophilum isolates?

When analyzing nuoA sequence variations, implement these methodological considerations:

  • Multiple sequence alignment strategy:

    • Use progressive alignment algorithms (MUSCLE, MAFFT) for protein sequences

    • Apply codon-aware aligners for nucleotide sequences

    • Manually inspect alignments in regions with insertions/deletions

  • Phylogenetic analysis:

    • Select appropriate evolutionary models using model testing approaches

    • Apply maximum likelihood or Bayesian inference methods

    • Assess node support through bootstrapping or posterior probabilities

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify selection signatures

    • Perform site-specific selection tests (FUBAR, MEME)

    • Evaluate branch-site models for lineage-specific selection

  • Structural mapping of variations:

    • Map variants onto predicted protein structures

    • Evaluate conservation in functionally important regions

    • Assess potential impact on protein-protein interactions within Complex I

  • Association with strain metadata:

    • Correlate sequence variations with host species origins

    • Analyze relationships with geographical distribution

    • Evaluate connections to serotype and PCR-typing results

F. psychrophilum genomic studies reveal evidence of gene exchange through recombination at certain loci , suggesting that respiratory chain components may also display strain-specific variations that could affect function or adaptation to different hosts or environments.

How does F. psychrophilum nuoA compare structurally and functionally with homologs from other fish pathogens?

Comparative analysis of nuoA across fish pathogens provides valuable evolutionary and functional insights:

  • Structural comparison methodologies:

    • Generate homology models using experimentally determined Complex I structures

    • Apply molecular dynamics simulations to evaluate stability at different temperatures

    • Analyze conservation of critical residues across psychrophilic and mesophilic species

  • Cold-adaptation features assessment:

    • Identify amino acid composition differences characteristic of cold-adapted proteins

    • Analyze predicted flexibility and rigidity patterns

    • Evaluate hydrogen bonding networks and salt bridges that may contribute to psychrophilic adaptation

  • Functional complementation approaches:

    • Express nuoA homologs from different pathogens in a common genetic background

    • Evaluate functional complementation at different temperatures

    • Measure enzymatic parameters (Km, Vmax, temperature optima) for different homologs

Table 4: Comparative Features of nuoA from Selected Fish Pathogens

FeatureF. psychrophilumA. salmonicidaY. ruckeriV. anguillarum
Growth temperature4-20°C5-25°C5-35°C10-35°C
Predicted flexibilityHigherModerateModerateLower
Charged residuesReducedModerateModerateHigher
Hydrophobic coreReducedModerateModerateCompact
Surface hydrophilicityIncreasedModerateModerateReduced

Note: These features are predicted based on general patterns observed in cold-adapted proteins and may vary in actual structures

What insights can researchers gain by studying nuoA expression under different environmental stressors relevant to fish pathogenesis?

Environmental stress response studies for nuoA should consider:

  • Experimental design considerations:

    • Simulate relevant environmental conditions (temperature shifts, oxidative stress, antimicrobials)

    • Include appropriate time-course measurements to capture dynamic responses

    • Apply consistent stress conditions across different strains for valid comparisons

  • Technical approaches:

    • Use RT-qPCR for targeted expression analysis

    • Apply RNA-seq for genome-wide context of nuoA regulation

    • Implement reporter gene constructs for real-time monitoring

  • Stress conditions to evaluate:

    • Temperature fluctuations (4°C to 20°C)

    • Oxidative stress (hydrogen peroxide, superoxide generators)

    • Nutrient limitation (iron restriction, carbon source variation)

    • Host-relevant antimicrobial compounds

    • Biofilm vs. planktonic growth conditions

  • Data interpretation framework:

    • Compare expression profiles across multiple stressors

    • Identify shared and unique response patterns

    • Place nuoA regulation in context of global stress responses

F. psychrophilum research indicates that biofilm formation may represent an important adaptation to environmental stress, with differentially expressed genes compared to planktonic cells . Understanding how respiratory chain components like nuoA respond to these conditions provides insight into bacterial adaptation and persistence mechanisms in aquaculture settings.

What are the common challenges in generating knockout mutants of F. psychrophilum nuoA and how can they be addressed?

Generating nuoA mutants in F. psychrophilum presents several challenges:

  • Genetic manipulation barriers:

    • Limited availability of optimized genetic tools for F. psychrophilum

    • Low transformation efficiency in psychrophilic bacteria

    • Potential essentiality of nuoA for bacterial viability

  • Methodological solutions:

    • Use temperature-sensitive plasmids that can replicate at lower temperatures

    • Optimize electroporation protocols specifically for F. psychrophilum

    • Consider conditional knockout approaches if nuoA is essential

    • Implement CRISPR-Cas9 systems optimized for low-temperature function

  • Validation approaches:

    • PCR verification of desired genetic modifications

    • Whole-genome sequencing to confirm clean genetic alterations

    • RT-qPCR to verify gene expression changes

    • Phenotypic characterization (growth curves, respiratory activity)

  • Alternative approaches:

    • RNA interference or antisense RNA strategies for knockdown rather than knockout

    • Heterologous expression systems to study protein function

    • Dominant negative mutants to disrupt function in wild-type background

How can researchers address challenges in studying protein-protein interactions involving nuoA in the context of F. psychrophilum Complex I?

Studying nuoA interactions within Complex I requires specialized approaches:

  • Membrane protein interaction challenges:

    • Hydrophobic nature complicates traditional interaction assays

    • Maintaining native conformation during purification

    • Preserving weak or transient interactions

  • Recommended methodologies:

    • Bacterial two-hybrid systems modified for membrane proteins

    • Chemical cross-linking followed by mass spectrometry

    • Co-immunoprecipitation with gentle detergent conditions

    • FRET-based approaches for in vivo interaction studies

  • Validation strategies:

    • Multiple complementary techniques to confirm interactions

    • Controls to distinguish specific from non-specific interactions

    • Competition assays with unlabeled proteins

    • Mutagenesis of predicted interaction interfaces

  • Structural biology approaches:

    • Cryo-electron microscopy of purified Complex I

    • X-ray crystallography of subcomplexes

    • Hydrogen-deuterium exchange mass spectrometry

    • In silico molecular docking validated by experimental data

Understanding these protein interactions provides valuable insight into how F. psychrophilum adapts its respiratory machinery to function effectively at lower temperatures, potentially contributing to its pathogenicity in coldwater environments.

What emerging technologies hold promise for advancing our understanding of F. psychrophilum nuoA and respiratory chain function?

Several cutting-edge technologies offer new avenues for nuoA research:

These emerging technologies will help researchers better understand how F. psychrophilum adapts its respiratory machinery to function during infection and under various environmental stresses relevant to fish pathogenesis.

How might targeting nuoA and other respiratory chain components lead to novel control strategies for F. psychrophilum infections?

Respiratory chain-targeted control strategies present promising research directions:

  • Drug development approaches:

    • Structure-based design of specific inhibitors targeting unique features of F. psychrophilum nuoA

    • Repurposing existing respiratory chain inhibitors with favorable selectivity profiles

    • Computational screening followed by experimental validation

  • Vaccine development strategies:

    • Evaluate recombinant nuoA as potential vaccine antigen

    • Design peptide vaccines targeting exposed epitopes

    • Consider multicomponent vaccines incorporating respiratory chain antigens alongside known protective antigens

  • Delivery system optimization:

    • Develop cold-water stable formulations

    • Optimize for oral delivery in aquaculture feed

    • Design controlled-release systems for sustained immunity

  • Efficacy testing frameworks:

    • In vitro growth inhibition assays

    • Cell culture infection models measuring cytotoxicity reduction

    • Challenge studies in relevant fish species with different strain types

Research indicates strong host-specificity patterns in F. psychrophilum types , suggesting that therapeutic approaches targeting respiratory chain components should consider strain diversity and host-specific adaptations for maximum efficacy in different aquaculture settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.