Recombinant Flavobacterium psychrophilum NADH-quinone oxidoreductase subunit K (nuoK)

What is Recombinant Flavobacterium psychrophilum NADH-quinone oxidoreductase subunit K (nuoK)?

Recombinant Flavobacterium psychrophilum NADH-quinone oxidoreductase subunit K (nuoK) is a full-length protein (1-106 amino acids) expressed in E. coli systems with an N-terminal His-tag. The protein is derived from Flavobacterium psychrophilum and corresponds to the UniProt ID A6H1Q3. NuoK functions as a subunit of the NADH dehydrogenase I complex (also known as NDH-1), which plays a critical role in bacterial electron transport chains and energy metabolism. This recombinant protein is typically supplied as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE analysis .

The amino acid sequence of this protein is:
MNNILVEIGIENYIYLCVVLFCIGIFGVLYRRNAIIMFMSIEIMLNAVNLLFVAFSTFHQDAQGQVFVFFSMAVAAAEVAVGLAILVSIYRNLSSIDIDNLKNLKG

How does Flavobacterium psychrophilum nuoK compare to homologous proteins in other species?

The sequence alignment reveals highly conserved regions critical for function, particularly in the transmembrane domains and binding sites. The variations, especially in the N-terminal region, might contribute to species-specific adaptations related to cold environment tolerance in F. psychrophilum .

What are the recommended storage conditions for recombinant nuoK protein?

Proper storage of recombinant nuoK protein is essential for maintaining structural integrity and biological activity. The protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple uses to avoid degradation from repeated freeze-thaw cycles. For short-term storage, working aliquots can be maintained at 4°C for up to one week. The lyophilized protein is typically stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

For reconstitution, a brief centrifugation of the vial prior to opening is recommended to bring contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage. The standard final concentration of glycerol used is 50% .

How can I implement a Solomon 4-Group Design for nuoK functional studies?

The Solomon 4-Group Design offers robust control for potential testing effects when studying nuoK function. This design incorporates four groups: two experimental and two control, with only one experimental group and one control group receiving pretests. This structure allows researchers to determine whether pretest measurements influence the experimental outcomes.

Implementation steps:

• Randomly assign samples to four groups

• Conduct pretests on Groups 1 and 2 (e.g., baseline electron transport activity)

• Administer recombinant nuoK to Groups 1 and 3

• Conduct posttests on all four groups

• Analyze data to assess both treatment effects and potential pretest influence

This design is particularly valuable when studying nuoK in complex systems where initial measurements might sensitize the experimental system to subsequent treatments .

How should I address data that contradicts my hypothesis about nuoK function?

When experimental data contradicts your hypothesis about nuoK function, a systematic approach to understanding the contradiction is essential. Begin by thoroughly examining the data to identify specific discrepancies, paying particular attention to outliers that may have influenced results. Compare your findings with existing literature on NADH-quinone oxidoreductase complexes to contextualize unexpected outcomes .

Methodological approach to contradictory data:

• Reevaluate initial assumptions about nuoK structure and function

• Review experimental design for potential confounding variables

• Consider alternative explanations for the observed phenomena

• Verify reagent quality, including recombinant protein purity

• Refine experimental variables and implement additional controls

Unexpected results should be viewed as opportunities for discovery rather than experimental failures. Many significant scientific advances have emerged from contradictory data that challenged established paradigms. Document all observations meticulously, as seemingly anomalous results may reveal novel aspects of nuoK function or interaction partners .

What functional assays can effectively measure nuoK activity?

Measuring nuoK activity requires specialized assays that can detect its contribution to NADH-quinone oxidoreductase function. As nuoK is a membrane-embedded subunit of a larger complex, functional assays typically focus on reconstitution systems or whole-complex activity measurements.

When designing functional assays, researchers must consider that isolated nuoK may not show activity outside of the complete complex. Therefore, co-expression with partner subunits or reconstitution into membrane systems may be necessary for meaningful functional studies .

What are common challenges in recombinant nuoK expression and purification?

Recombinant expression and purification of membrane proteins like nuoK present several challenges that researchers frequently encounter. The hydrophobic nature of nuoK can lead to protein aggregation, inclusion body formation, and toxicity to the host organism during overexpression.

Common challenges and solutions include:

• Inclusion body formation: Express at lower temperatures (16-20°C) to slow protein production and allow proper folding

• Low yield: Optimize codon usage for E. coli expression or explore alternative expression systems

• Protein instability: Incorporate stabilizing agents such as glycerol (5-50%) and trehalose (6%) in storage buffers

• Purification difficulties: Utilize the His-tag for initial purification, followed by size exclusion chromatography to remove aggregates

• Functional reconstitution: Incorporate the purified protein into lipid nanodiscs or liposomes to restore native-like membrane environment

When working with the lyophilized protein, ensure proper reconstitution by following the recommended protocol of brief centrifugation prior to opening, reconstitution in deionized sterile water to 0.1-1.0 mg/mL, and addition of glycerol for storage stability .

How can I optimize experimental conditions when working with recombinant nuoK?

Optimizing experimental conditions for nuoK studies requires systematic evaluation of multiple parameters that affect protein stability and function. Begin by assessing buffer composition, paying particular attention to pH, ionic strength, and the presence of stabilizing agents.

For functional studies, consider these optimization strategies:

• Temperature selection: While standard experiments may be conducted at 25-37°C, exploring lower temperatures (4-15°C) may provide insights into the cold adaptation mechanisms of F. psychrophilum nuoK

• Detergent screening: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal solubilization conditions

• Lipid composition: When reconstituting nuoK into membranes, evaluate different lipid compositions to identify those that best support activity

• Experimental design refinement: Implement Solomon 4-Group Design when evaluating treatment effects to control for testing influences

When experimental data contradicts hypotheses, systematically examine all variables, consider alternative explanations, and refine the experimental approach accordingly. Document all conditions meticulously to ensure reproducibility and facilitate troubleshooting .

What statistical approaches are appropriate for analyzing nuoK experimental data?

Selecting appropriate statistical methods for nuoK research depends on the experimental design and data characteristics. For comparing treatment groups in experimental designs, parametric tests like t-tests or ANOVA are commonly used when data meets assumptions of normality and homogeneity of variance.

For Solomon 4-Group Designs, specialized analysis comparing pretested and non-pretested groups can help identify whether measurement effects influence experimental outcomes. When facing unexpected results that contradict hypotheses, exploratory data analysis techniques should be employed to identify patterns and potential explanations .

Visualizing data through multiple representations (scatter plots, box plots, heat maps) can reveal patterns not immediately apparent in numerical analyses. Statistical software packages like R, Python (with scipy.stats), or GraphPad Prism provide tools for comprehensive analysis of nuoK experimental data.

How should I interpret comparative studies between F. psychrophilum and F. johnsoniae nuoK proteins?

When interpreting comparative studies between nuoK proteins from F. psychrophilum and F. johnsoniae, consider both sequence-level and functional differences within their biological context. While both proteins share the same length (106 amino acids) and considerable sequence homology, key differences exist that may confer species-specific adaptations.

Analysis framework for comparative studies:

• Sequence conservation pattern: The high degree of sequence conservation (particularly in functional domains) suggests evolutionary pressure to maintain essential functions of the NADH-quinone oxidoreductase complex

• N-terminal variations: The different N-terminal sequences (MNNILVEIGIE vs. MGNILNQIGIE) may influence membrane insertion, subunit interactions, or regulatory properties

• Functional implications: F. psychrophilum is adapted to cold environments, which may be reflected in nuoK structural features that maintain flexibility and activity at lower temperatures

• Integration with whole-organism physiology: Consider how nuoK differences relate to the distinct ecological niches of these bacterial species

When experimental data reveals functional differences between these homologous proteins, carefully consider whether these reflect true biological adaptations or are artifacts of experimental conditions. Cross-validation with multiple methodological approaches strengthens interpretation of comparative findings .