Recombinant Fluoroquinolones export permease protein Rv2686c/MT2760 (Rv2686c, MT2760)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Fluoroquinolones export permease protein Rv2686c/MT2760 (Rv2686c, MT2760) is a transmembrane protein encoded by the Rv2686c gene in Mycobacterium tuberculosis. It functions as part of an ATP-binding cassette (ABC) transporter complex (Rv2686c-Rv2687c-Rv2688c) that actively exports fluoroquinolone antibiotics, contributing to bacterial resistance against these drugs . This protein has been recombinantly produced for research purposes to study its role in antibiotic resistance mechanisms and develop therapeutic strategies .

Primary Sequence and Domains

  • Gene Locus: Rv2686c (MT2760 in M. tuberculosis CDC1551) .

  • Protein Length: 252 amino acids (partial sequences used in recombinant production span residues 1–252) .

  • Key Domains:

    • Integral membrane leucine/alanine/valine-rich region.

    • ABC transporter permease domain involved in substrate translocation .

Mechanism of Action

Rv2686c operates as the permease subunit of the ABC transporter complex, enabling energy-dependent efflux of fluoroquinolones (e.g., ciprofloxacin, moxifloxacin) from bacterial cells . Key findings include:

  • Resistance Profile: Confers resistance to ciprofloxacin (4–8x increase in MIC) and partial resistance to norfloxacin, sparfloxacin, and moxifloxacin .

  • Efflux Inhibition: Resistance is reduced by efflux pump inhibitors like reserpine, verapamil, and carbonyl cyanide m-chlorophenylhydrazone .

Genetic and Biochemical Evidence

  • Operon Function: Co-expression of Rv2686c with Rv2687c (ATPase) and Rv2688c (substrate-binding protein) is required for full transporter activity .

  • Energy Dependency: Ciprofloxacin efflux is ATP-dependent, confirmed via assays in Mycobacterium smegmatis .

Table 2: Key Functional Studies

Study FocusMethodologyResultsCitation
Efflux ActivityFluoroquinolone MIC assaysRv2686c overexpression increased ciprofloxacin MIC 4–8x in M. smegmatis
Inhibitor EffectReserpine/verapamil co-treatmentReduced resistance levels by 50–70%
Operon DeletionTransposon mutagenesisNon-essential for in vitro growth but critical for drug resistance

Production Systems

Recombinant Rv2686c is produced in heterologous systems such as E. coli, yeast, or mammalian cells, with purification protocols yielding >85% purity .

Antibiotic Resistance Management

Understanding Rv2686c’s role in fluoroquinolone efflux provides insights into:

  • Drug Design: Targeting ABC transporters to inhibit efflux and restore antibiotic efficacy .

  • Diagnostics: Detecting transporter overexpression in drug-resistant M. tuberculosis strains .

Limitations and Future Directions

  • Substrate Specificity: The exact structural determinants for fluoroquinolone binding remain unclear .

  • Therapeutic Targeting: Development of efflux pump inhibitors requires further in vivo validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it for your order.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Target Names
Rv2686c, MT2760
Target Protein Sequence
MRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYG FDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAAT VMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVR ALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIV WVLFRRFRAKHA
Uniprot No.

Q&A

What is the Rv2686c protein and what is its function in Mycobacterium tuberculosis?

Rv2686c is a transmembrane protein that functions as part of the Rv2686c-Rv2687c-Rv2688c ABC transporter system in M. tuberculosis. This protein serves as a permease component of the transporter complex, which actively pumps out fluoroquinolone antibiotics, particularly ciprofloxacin, from bacterial cells. The protein contains six transmembrane segments (TMS) and works in conjunction with Rv2687c (also containing six TMS) and Rv2688c (containing the nucleotide binding domain responsible for ATP hydrolysis) .

The three genes are organized in an operon-like structure where the 5' and 3' ends of the Rv2687c open reading frame overlap with the stop codon of Rv2688c and the translation start codon of Rv2686c, respectively, suggesting they are cotranscribed . Together, this system contributes to fluoroquinolone resistance in M. tuberculosis by actively exporting these antibiotics from the bacterial cell.

How is the Rv2686c-Rv2687c-Rv2688c operon organized in the M. tuberculosis genome?

The Rv2686c-Rv2687c-Rv2688c genes are arranged in an operon-like structure in the M. tuberculosis genome. The organization is characterized by overlapping reading frames: the 5' end of the Rv2687c open reading frame overlaps with the stop codon of Rv2688c, while the 3' end of Rv2687c overlaps with the translation start codon of Rv2686c . This genomic organization strongly suggests that these three genes are cotranscribed, functioning as a single transcriptional unit.

The operon structure is conserved in related mycobacterial species, as homologous genes with the same operon-like organization have been identified in Mycobacterium smegmatis through BLAST analysis of sequence data . This conservation across mycobacterial species highlights the evolutionary importance of this transporter system.

How can researchers clone and express the Rv2686c gene or the complete operon for functional studies?

To clone and express the Rv2686c gene or the complete Rv2686c-Rv2687c-Rv2688c operon, researchers should follow these methodological steps:

  • PCR Amplification: Design appropriate primers for amplifying either the entire operon or individual genes. Based on previous successful experiments, primers such as RG357 (5'-CAATCGATGTGAGAGCGATATC-3') and RG330 (5'-TTATCGATTCACGCGTGCTTAG-3') can be used for Rv2686c, while RG360 (5'-TTATCGATATGACGGCGCTCAA-3') and RG330 can be used for the entire operon . Include appropriate restriction sites in the primers (ClaI sites were used in previous studies).

  • Initial Cloning: Amplify the target DNA from M. tuberculosis H37Rv genomic DNA, clone into an intermediate vector (such as pGEM-T Easy), and verify the sequence .

  • Expression Vector Construction: Subclone the verified sequences into a mycobacterial expression vector. Previous studies successfully used pSODIT-2 shuttle expression vector to generate plasmids like pMP178 (containing the entire operon) or pM45 (containing only Rv2686c) .

  • Transformation: Transform the expression constructs into the desired host system. For functional studies, M. smegmatis mc²155 has been successfully used as an expression host via electroporation .

  • Expression Verification: Confirm protein expression through Western blotting or functional assays (such as antibiotic resistance testing, as described in previous studies) .

This approach allows for functional characterization of either the individual components or the entire transporter complex in a heterologous expression system.

What are the optimal conditions for purifying recombinant Rv2686c protein for biochemical studies?

For optimal purification of recombinant Rv2686c protein with N-terminal His-tag as described in commercial preparations , researchers should follow these guidelines:

  • Expression System: Express the protein in E. coli using a vector that incorporates an N-terminal His-tag to facilitate purification .

  • Cell Lysis: After inducing protein expression, harvest cells and lyse using appropriate buffer systems that maintain membrane protein stability. Consider using mild detergents for extraction since Rv2686c is a membrane protein with six transmembrane segments .

  • Affinity Chromatography: Purify the His-tagged protein using Ni-NTA or similar metal affinity chromatography. For membrane proteins like Rv2686c, include detergents in all purification buffers to maintain protein solubility.

  • Buffer Optimization: Final purified protein can be stored in Tris/PBS-based buffer at pH 8.0 with 6% trehalose as a stabilizing agent .

  • Storage: The purified protein can be lyophilized for long-term storage. For working aliquots, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol (final concentration) before storing at -20°C/-80°C .

  • Stability Considerations: Avoid repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

These conditions have been successfully used for commercial preparation of recombinant Rv2686c protein and can be adapted for research laboratory settings.

What experimental approaches can be used to measure the fluoroquinolone efflux activity of the Rv2686c-Rv2687c-Rv2688c transporter?

To measure the fluoroquinolone efflux activity of the Rv2686c-Rv2687c-Rv2688c transporter, researchers can employ the following experimental approaches:

  • Antibiotic Susceptibility Testing: Determine the Minimum Inhibitory Concentration (MIC) of various fluoroquinolones against bacterial strains expressing the transporter versus control strains. Previous studies demonstrated increased MICs of ciprofloxacin (eightfold), norfloxacin (twofold), moxifloxacin (twofold), and sparfloxacin (twofold) in M. smegmatis expressing the complete operon . This can be performed using:

    • Plate dilution method

    • Microdilution in liquid medium

    • E-test strips

  • Fluoroquinolone Accumulation Assays: Measure the intracellular accumulation of fluoroquinolones (particularly ciprofloxacin) using:

    • Fluorescence-based assays (many fluoroquinolones are naturally fluorescent)

    • Radiolabeled antibiotics to track uptake and efflux rates

  • ATP Hydrolysis Assays: Since this is an ABC transporter that requires ATP hydrolysis, measure the ATPase activity of the purified Rv2688c component (which contains the nucleotide binding domain) in the presence and absence of fluoroquinolone substrates .

  • Transport Assays in Membrane Vesicles: Prepare inverted membrane vesicles from bacteria expressing the transporter and measure ATP-dependent uptake of fluoroquinolones into these vesicles (which would represent efflux from intact cells).

  • Genetic Complementation Studies: Express the transporter genes in fluoroquinolone-sensitive strains and assess the restoration of resistance, as previously demonstrated with M. smegmatis expressing the operon from M. tuberculosis .

These methodologies provide multiple approaches to quantitatively assess the fluoroquinolone efflux function of this ABC transporter system.

How does the Rv2686c-Rv2687c-Rv2688c efflux pump contribute to fluoroquinolone resistance in clinical isolates of M. tuberculosis?

The Rv2686c-Rv2687c-Rv2688c efflux pump contributes to fluoroquinolone resistance in clinical isolates of M. tuberculosis through an active drug efflux mechanism that complements other resistance mechanisms. While 42-85% of fluoroquinolone-resistant clinical isolates show mutations in the gyrA gene (encoding DNA gyrase, the primary target of fluoroquinolones), the remaining isolates may rely on efflux mechanisms for their resistance phenotype .

The ABC transporter encoded by Rv2686c-Rv2687c-Rv2688c actively pumps out fluoroquinolones, particularly ciprofloxacin, using ATP hydrolysis as an energy source. This reduces the intracellular concentration of these antibiotics to sub-inhibitory levels, allowing bacterial survival despite antibiotic treatment . Studies have shown that expression of this transporter system in M. smegmatis confers up to eightfold increased resistance to ciprofloxacin and twofold increased resistance to newer fluoroquinolones like moxifloxacin and sparfloxacin .

This efflux mechanism may be particularly important in:

  • Early stages of resistance development, before target mutations occur

  • Clinical isolates that lack gyrA mutations but still exhibit fluoroquinolone resistance

  • Isolates with low-level resistance that could serve as a stepping stone to high-level resistance through subsequent acquisition of target mutations

Analysis of clinical isolates with unexplained fluoroquinolone resistance should include assessment of expression levels of the Rv2686c-Rv2687c-Rv2688c operon to determine its contribution to the resistance phenotype .

How does the substrate specificity of the Rv2686c-Rv2687c-Rv2688c transporter compare with other known ABC transporters in mycobacteria?

The Rv2686c-Rv2687c-Rv2688c transporter demonstrates a relatively narrow substrate specificity compared to other mycobacterial transporters, with a strong preference for fluoroquinolones. Experimental evidence shows it confers significant resistance to ciprofloxacin (eightfold increase in MIC) and moderate resistance to norfloxacin, moxifloxacin, and sparfloxacin (twofold increase) . Importantly, this transporter does not appear to significantly transport other classes of antibiotics, as no substantial changes in MICs were observed for non-fluoroquinolone antibiotics tested .

This substrate specificity profile differs from other known mycobacterial transporters:

  • LfrA in M. smegmatis: A non-ABC transporter that mediates efflux of multiple fluoroquinolones but also transports other compounds like acriflavine and ethidium bromide .

  • Phosphate uptake ABC transporter in M. smegmatis: While involved in inorganic phosphate transport, it has been correlated with fluoroquinolone resistance when overexpressed, representing a more diverse functional profile than the Rv2686c-Rv2687c-Rv2688c system .

  • Rv0194 from M. tuberculosis: The only other characterized ABC transporter involved in drug resistance in M. tuberculosis (as of the time of these studies), which has broader substrate specificity than Rv2686c-Rv2687c-Rv2688c .

The specific fluoroquinolone preference of the Rv2686c-Rv2687c-Rv2688c transporter, particularly for ciprofloxacin, suggests structural features of the transporter binding pocket that are optimized for interaction with this class of compounds. This specificity makes it unique among mycobacterial transporters and potentially a valuable target for inhibitors that could restore fluoroquinolone sensitivity .

What are common challenges when working with recombinant Rv2686c protein and how can they be addressed?

Researchers working with recombinant Rv2686c protein may encounter several challenges due to its nature as a membrane protein with six transmembrane segments . Here are common issues and their solutions:

  • Low Expression Levels:

    • Problem: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize expression conditions (temperature, induction time, inducer concentration); use specialized E. coli strains designed for membrane protein expression; consider expression in mycobacterial hosts for native-like membrane environment .

  • Protein Aggregation/Insolubility:

    • Problem: Transmembrane proteins tend to aggregate when overexpressed.

    • Solution: Include appropriate detergents during extraction and purification; use mild solubilization conditions; consider fusion partners that enhance solubility; perform extraction at 4°C to minimize aggregation .

  • Protein Instability:

    • Problem: Purified Rv2686c may be unstable in solution.

    • Solution: Add stabilizing agents like trehalose (6%) as used in commercial preparations; maintain appropriate pH (around pH 8.0); avoid repeated freeze-thaw cycles; store working aliquots at 4°C for short periods only (up to one week) .

  • Loss of Function:

    • Problem: Purified protein may lose transport activity.

    • Solution: Verify functional integrity through reconstitution in liposomes or nanodiscs; partner with other components (Rv2687c, Rv2688c) for complete functional studies; include glycerol (5-50%) in storage buffers .

  • Challenging Functional Assays:

    • Problem: Difficult to measure transport activity of isolated protein.

    • Solution: Consider whole-cell approaches by expressing in model organisms like M. smegmatis; measure antibiotic MICs as a proxy for function; pair with ATPase assays of the Rv2688c component to assess coupled activity .

By addressing these challenges with the appropriate technical approaches, researchers can successfully work with this challenging but important membrane protein.

How can researchers distinguish between the effects of the Rv2686c-Rv2687c-Rv2688c efflux pump and other resistance mechanisms in M. tuberculosis?

Distinguishing between the effects of the Rv2686c-Rv2687c-Rv2688c efflux pump and other resistance mechanisms in M. tuberculosis requires a multi-faceted experimental approach:

  • Genetic Analysis:

    • Sequence the gyrA and gyrB genes to identify target mutations that are the primary mechanism of fluoroquinolone resistance (present in 42-85% of resistant clinical isolates) .

    • Analyze expression levels of the Rv2686c-Rv2687c-Rv2688c operon using RT-PCR or RNA-seq to detect overexpression.

    • Perform whole-genome sequencing to identify any other potential resistance mechanisms.

  • Efflux Pump Inhibitor Studies:

    • Test the effect of broad-spectrum efflux pump inhibitors on fluoroquinolone MICs. A significant reduction in MIC in the presence of inhibitors would suggest efflux pump involvement.

    • Compare the effects of inhibitors on strains with known target mutations versus those without to quantify the contribution of efflux.

  • Gene Knockout/Complementation:

    • Create knockout mutants of the Rv2686c-Rv2687c-Rv2688c operon and measure the change in fluoroquinolone susceptibility.

    • Complement wild-type genes back into knockout strains to confirm specificity of the effect.

    • Heterologous expression of the operon in a sensitive strain should confer resistance if the pump is sufficient for resistance .

  • Substrate Profiling:

    • The Rv2686c-Rv2687c-Rv2688c pump shows specificity for fluoroquinolones, with limited effect on other antibiotic classes .

    • If resistance extends beyond fluoroquinolones to unrelated compounds, other mechanisms are likely involved.

  • Direct Transport Assays:

    • Measure the accumulation of fluoroquinolones in cells with and without functional pump expression.

    • Time-course studies of antibiotic accumulation can differentiate between efflux activity and other mechanisms like target modification.

  • ATP Dependence:

    • As an ABC transporter, Rv2686c-Rv2687c-Rv2688c activity is ATP-dependent .

    • Depletion of cellular ATP should reduce resistance if the pump is the primary mechanism, but would not affect resistance due to target mutations.

How should researchers interpret conflicting data when analyzing the contribution of Rv2686c to drug resistance in different experimental systems?

When faced with conflicting data regarding Rv2686c's contribution to drug resistance across different experimental systems, researchers should employ the following analytical framework:

  • Evaluate Experimental Context Differences:

    • Host Organism Variations: Results may differ between experiments using M. tuberculosis, M. smegmatis, or E. coli expression systems. For instance, when expressed alone in M. smegmatis, Rv2686c conferred 4-fold increased ciprofloxacin resistance, possibly due to interaction with native homologous proteins . Consider:

      • Membrane composition differences

      • Presence of homologous proteins that may complement function

      • Expression levels in different systems

  • Analyze Transporter Component Interactions:

    • Subunit Dependency: The complete operon (Rv2686c-Rv2687c-Rv2688c) showed 8-fold increased ciprofloxacin resistance, while Rv2686c alone showed 4-fold increase . This suggests:

      • Partial functionality of incomplete complexes

      • Potential interaction with host components

      • Requirement for all three components for maximal activity

  • Scrutinize Methodological Variations:

    • MIC Determination Methods: Different results may emerge from:

      • Plate dilution versus microdilution methods

      • Media composition variations

      • Inoculum size differences

    • Standardize Critical Parameters: When comparing across studies, normalize for:

      • Growth conditions

      • Expression levels (via Western blotting)

      • Antibiotic exposure times

  • Consider Substrate Specificity Patterns:

    • Fluoroquinolone Type: The transporter shows greater effect on ciprofloxacin (8-fold MIC increase) than on other fluoroquinolones like norfloxacin, moxifloxacin, and sparfloxacin (2-fold increases) . Conflicting results may stem from:

      • Testing different fluoroquinolones

      • Structural variations in tested compounds

      • Concentration ranges examined

  • Apply Statistical Rigor:

    • Replicate Analysis: Ensure sufficient replication to distinguish biological significance from experimental noise

    • Meta-analysis Approach: When comparing across studies, use statistical methods to integrate results from multiple experiments

  • Probe Mechanism Through Multiple Techniques:

    • Complementary Approaches: Validate findings through:

      • Direct transport assays

      • Gene expression analysis

      • Protein-protein interaction studies

      • In vivo infection models where feasible

By systematically addressing these factors, researchers can reconcile seemingly conflicting data and develop a more nuanced understanding of Rv2686c's true contribution to fluoroquinolone resistance in mycobacteria.

What are the potential applications of Rv2686c inhibitors in overcoming fluoroquinolone resistance in M. tuberculosis?

The development of Rv2686c inhibitors presents a promising strategy for combating fluoroquinolone resistance in M. tuberculosis, with several potential applications:

  • Adjuvant Therapy with Existing Fluoroquinolones:

    • Inhibitors targeting Rv2686c could restore sensitivity to fluoroquinolones, particularly ciprofloxacin, in resistant strains where efflux is the primary mechanism .

    • This approach could revitalize the use of earlier generation fluoroquinolones that have become less effective due to resistance.

    • Combination therapy could potentially reduce the required dose of fluoroquinolones, minimizing side effects.

  • Prevention of Resistance Development:

    • Efflux pumps like Rv2686c-Rv2687c-Rv2688c may represent an early step in resistance development, before target mutations occur .

    • Inhibiting this transporter could potentially slow the emergence of high-level resistance in M. tuberculosis populations during fluoroquinolone therapy.

    • This would be especially valuable for newer fluoroquinolones like moxifloxacin that are important components of MDR-TB treatment regimens.

  • Activity Against Multiple Resistance Mechanisms:

    • In strains with both target mutations and efflux-mediated resistance, Rv2686c inhibitors could address the efflux component, potentially restoring partial sensitivity.

    • This multi-target approach might be particularly effective against extensively drug-resistant (XDR) TB strains.

  • Screening Tool for Mechanism Determination:

    • Rv2686c inhibitors could serve as diagnostic tools to determine whether fluoroquinolone resistance in clinical isolates is mediated by efflux or target mutations.

    • This information could guide optimal therapy selection.

  • Structure-Based Drug Design Platform:

    • The transmembrane nature of Rv2686c presents unique binding sites that differ from traditional antibiotic targets.

    • Novel chemical scaffolds targeting this protein could form the basis for new classes of antimycobacterial agents.

The development of such inhibitors would require detailed structural characterization of Rv2686c, identification of critical residues involved in substrate binding, and high-throughput screening approaches to identify lead compounds that specifically inhibit this transporter without affecting host ABC transporters.

How do genome-wide association studies (GWAS) contribute to our understanding of the role of Rv2686c variants in clinical fluoroquinolone resistance?

Genome-wide association studies (GWAS) offer valuable insights into the role of Rv2686c variants in clinical fluoroquinolone resistance through several key contributions:

  • Identification of Resistance-Associated Polymorphisms:

    • GWAS can identify single nucleotide polymorphisms (SNPs) or other genetic variations in the Rv2686c gene that correlate with fluoroquinolone resistance in clinical isolates.

    • This approach can detect subtle genetic changes that might enhance efflux efficiency but would be missed by traditional phenotypic testing.

    • Such studies complement the existing knowledge that while 42-85% of fluoroquinolone-resistant clinical isolates have gyrA mutations, the remaining isolates may rely on alternative mechanisms like enhanced efflux .

  • Population Genetics of Resistance:

    • GWAS can reveal geographical or lineage-specific variations in Rv2686c that may contribute to differences in fluoroquinolone resistance patterns among M. tuberculosis populations.

    • This information helps track the evolution and spread of resistance-conferring variants across different TB epidemics.

  • Regulatory Element Identification:

    • Beyond coding sequences, GWAS can identify variations in promoter or other regulatory regions that may lead to overexpression of the Rv2686c-Rv2687c-Rv2688c operon.

    • Such regulatory mutations could enhance efflux activity without changing the protein sequence itself.

  • Multi-factorial Resistance Mechanisms:

    • GWAS can reveal epistatic interactions between Rv2686c variants and other genes involved in fluoroquinolone resistance (e.g., gyrA, gyrB, or other efflux pumps).

    • This helps construct a more comprehensive understanding of how multiple genetic factors may combine to produce clinical resistance phenotypes.

  • Biomarker Development:

    • Identification of specific Rv2686c variants associated with resistance could lead to the development of molecular diagnostic tools.

    • Such diagnostics could rapidly identify likely fluoroquinolone-resistant strains before conventional susceptibility testing is complete.

By linking genetic variations to clinical outcomes through GWAS approaches, researchers can better understand the full spectrum of mechanisms by which the Rv2686c component of this ABC transporter contributes to fluoroquinolone resistance in tuberculosis, ultimately informing more effective treatment strategies.

What is the potential role of the Rv2686c-Rv2687c-Rv2688c system in mycobacterial physiology beyond drug resistance?

While the Rv2686c-Rv2687c-Rv2688c system has been characterized primarily for its role in fluoroquinolone resistance, its potential physiological functions beyond drug efflux warrant investigation:

  • Natural Substrate Transport:

    • ABC transporters typically evolve to transport specific physiological substrates before being repurposed for drug efflux.

    • The high specificity for fluoroquinolones suggests this transporter may naturally export structurally similar endogenous compounds or environmental toxins encountered by M. tuberculosis .

    • Potential candidates include aromatic compounds with planar ring structures similar to the fluoroquinolone core.

  • Host-Pathogen Interaction:

    • The transporter may play a role in defending against host antimicrobial compounds during infection.

    • It could be involved in exporting host-derived antimicrobial peptides or other immune system compounds that target bacterial membranes.

    • This function would contribute to M. tuberculosis survival within macrophages and other hostile host environments.

  • Biofilm Formation and Persistence:

    • ABC transporters in other bacteria contribute to biofilm formation by exporting signaling molecules or biofilm matrix components.

    • The Rv2686c-Rv2687c-Rv2688c system might export quorum sensing molecules or other factors involved in establishing persistent tuberculosis infections.

  • Metabolite Homeostasis:

    • The system could function in maintaining cellular homeostasis by exporting toxic metabolic byproducts.

    • This function would be particularly important during adaptation to changing environmental conditions encountered during infection.

  • Membrane Composition Regulation:

    • Some ABC transporters are involved in lipid trafficking and membrane composition maintenance.

    • Given the unique and complex lipid composition of mycobacterial cell walls, this transporter might contribute to membrane integrity or remodeling.

  • Stress Response:

    • Expression analysis under various stress conditions (beyond antibiotic exposure) could reveal induction of this operon during specific physiological challenges.

    • Such patterns would suggest roles in general stress adaptation rather than specifically antibiotic resistance.

Understanding these potential physiological functions could provide insights into mycobacterial biology and potentially reveal new approaches for targeting this pathogen beyond conventional antibiotic therapy. It could also explain why this transporter system is conserved in mycobacterial species that rarely encounter fluoroquinolone antibiotics in their natural environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.