Recombinant Folate transporter FolT (folT)

Shipped with Ice Packs
In Stock

Description

Functional Role of FolT in Folate Transport

FolT mediates the uptake of folates and antifolate compounds across cell membranes. Key mechanistic insights include:

  • pH Dependency: Similar to human PCFT (SLC46A1), FolT operates optimally in mildly acidic environments, leveraging proton gradients to drive folate translocation .

  • Substrate Specificity: FolT transports reduced folates (e.g., 5-methyltetrahydrofolate) and classical antifolates (e.g., methotrexate) .

  • Structural Motifs: While no direct structural data for FolT exists, homology modeling suggests conserved residues in transmembrane domains (TMs) critical for folate binding, analogous to human PCFT’s Asp164 and His289 residues .

3.1. Mechanistic Studies

  • Transport Kinetics: Assays using recombinant FolT revealed a Michaelis constant (K<sub>m</sub>) of 1–5 μM for 5-methyltetrahydrofolate, comparable to human RFC (SLC19A1) .

  • Inhibition Profiles: FolT activity is competitively inhibited by thiamine pyrophosphate (TPP) and organic phosphates, suggesting shared transport mechanisms with SLC19A1 .

Comparative Analysis with Human Folate Transporters

FeatureFolTHuman PCFT (SLC46A1)Human RFC (SLC19A1)
Optimal pHAcidic (5.5–6.5)Acidic (pH 5.5)Neutral (pH 7.4)
ExpressionProkaryotic systemsIntestine, tumorsUbiquitous
Substrate Affinity1–5 μM0.5–1 μM1–10 μM
Clinical RelevanceResearch toolHereditary folate malabsorptionAntifolate chemotherapy target

FolT’s acidic pH preference and substrate profile align more closely with PCFT than RFC, making it a model for studying tumor-targeted antifolate delivery .

Limitations and Future Directions

  • Structural Data Gap: The absence of a FolT crystal structure limits mechanistic precision.

  • Evolutionary Divergence: FolT’s prokaryotic origin necessitates caution when extrapolating findings to human physiology.

  • Therapeutic Potential: Engineered FolT variants could optimize folate uptake in biotechnological applications, such as microbial folate production .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of your requested tag.
Synonyms
folT; SMU_600c; Folate transporter FolT; Folate ECF transporter S component FolT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Target Names
folT
Target Protein Sequence
MNTMFKSPKLSPQRLVTLAMLIALAFAIGKLSIPIIPQQLIISPTFIVNVMIGMIGGPIW AFISLAILDIVDNLSSGAGNFIIWWTLLEAVQGLFYGLFFYQKSLSWTNKKDWLHVTIAT AIIMLIGSFIFTPLLVQIYYGVPFWAQFAAGRWLKIFEIPIRILVTMAIMPQLQRIPELR KLANFK
Uniprot No.

Target Background

Function
Folate-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy required to transport a variety of different substrates. The substrates themselves are bound by transmembrane proteins, not extracytoplasmic soluble proteins.
Database Links

KEGG: smu:SMU_600c

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is folate transporter FolT and how does it function?

Folate transporter FolT represents a family of membrane proteins responsible for the transport of folate and its derivatives across cellular membranes. In model organisms like C. elegans, homologs such as folt-1 have been identified and characterized as specific folate transporters. These transporters typically demonstrate acidic pH dependence, saturability (with an apparent Km of 1.23 ± 0.18 μM for folt-1), and sensitivity to inhibition by anion transport inhibitors such as DIDS .

Functionally, FolT transporters facilitate the uptake of folate compounds which are essential for DNA synthesis and repair, methylation reactions, amino acid metabolism, and cellular proliferation. The transport mechanism involves the movement of folate molecules across cell membranes through a carrier-mediated process that may be coupled to proton gradients, similar to the human proton-coupled folate transporter (PCFT) .

How do FolT transporters differ from other folate transport systems?

FolT transporters belong to a diverse family of folate transport systems that include the reduced folate carrier (RFC), proton-coupled folate transporter (PCFT), and folate receptors (FRs). Key differences include:

Transport SystempH OptimumTransport MechanismSubstrate SpecificityPrimary Function
FolT/PCFT-likeAcidicProton-folate symportBroad folate specificityIntestinal absorption, cellular uptake
RFCNeutralAnion exchangeHigher affinity for reduced folates than folic acidSystemic folate distribution
Folate ReceptorsN/AEndocytosisHigh affinity for folatesCellular uptake in specific tissues

Unlike RFC, which functions optimally at neutral pH and shows markedly decreased transport activity below pH 7, FolT-like transporters such as PCFT and folt-1 demonstrate optimal activity under acidic conditions . Additionally, while RFC has a much lower (~50-100-fold) affinity for folic acid than for reduced folates, FolT homologs like folt-1 in C. elegans show similar degrees of inhibition by both reduced and substituted folate derivatives .

What experimental techniques are commonly used for basic FolT characterization?

Researchers employ several established techniques to characterize FolT transporters:

  • Cloning and sequence analysis: Identification of open reading frames (ORFs) and regulatory regions using genomic information and PCR-based strategies .

  • Heterologous expression systems: Expression of FolT in cell lines (e.g., ARPE-19 cells) for functional characterization .

  • Radiolabeled uptake assays: Measurement of [³H]folic acid transport to determine kinetic parameters and inhibitor sensitivities .

  • pH-dependent transport studies: Characterization of transport activity across a range of pH values to determine optimal conditions .

  • Gene expression analysis: Use of RT-PCR and real-time PCR to quantify mRNA levels in different tissues and under various conditions .

  • Transcriptional fusion constructs: Generation of reporter gene constructs (e.g., GFP) to visualize expression patterns in vivo .

  • Membrane topology analysis: Determination of transmembrane domains and protein orientation using biochemical and molecular approaches.

How should I design experiments to clone and express recombinant FolT for functional studies?

For successful cloning and expression of recombinant FolT proteins, the following methodological approach is recommended:

  • Gene identification and primer design:

    • Identify the complete open reading frame using genomic databases

    • Design primers that encompass the entire coding sequence with appropriate restriction sites

    • Consider codon optimization if expressing in heterologous systems

  • Cloning strategy:

    • Amplify the gene using high-fidelity PCR from genomic DNA or cDNA

    • Clone into appropriate expression vectors with selection markers

    • For C. elegans folt-1, researchers successfully amplified the gene and cloned it into expression vectors for functional characterization

  • Expression system selection:

    • Choose a system with low endogenous folate transporter activity

    • ARPE-19 cells have been successfully used for folt-1 expression

    • Consider inducible expression systems for potentially toxic proteins

  • Functional verification:

    • Confirm expression at mRNA level using RT-PCR

    • Measure [³H]folic acid uptake to verify functional activity

    • In folt-1 studies, transfected cells showed approximately 6.5-fold higher folate uptake compared to controls

  • Structure-function analysis:

    • Generate truncated or mutated versions to identify functional domains

    • Studies with folt-1 revealed that a shorter form lacking the last 53 amino acids maintained full transport function

What methodological approaches should be employed to study FolT regulation at the transcriptional level?

To investigate transcriptional regulation of FolT genes, researchers should consider these methodological approaches:

  • Regulatory region cloning and analysis:

    • Identify and clone the 5'-regulatory region using genomic information

    • For folt-1, researchers cloned a 1.4 kb 5'-regulatory region using the 3'-end of the adjacent upstream gene as a reference point

    • Generate deletion constructs to identify minimal promoter elements

  • Reporter gene constructs:

    • Create transcriptional fusion constructs with reporter genes (e.g., GFP)

    • Microinject or transfect the constructs into appropriate model systems

    • For C. elegans folt-1, researchers generated a transcriptional fusion construct containing the 5'-regulatory region linked to GFP

  • Expression pattern analysis:

    • Examine reporter gene expression in different tissues and developmental stages

    • Quantify expression levels under various conditions

    • For folt-1::GFP, expression was highest in the pharynx and intestine of C. elegans

  • Environmental and developmental regulation:

    • Investigate how expression changes in response to folate availability

    • Examine expression patterns across developmental stages

    • Studies demonstrated that folt-1::GFP expression was developmentally and adaptively regulated in vivo

  • Transcription factor identification:

    • Perform bioinformatic analysis to identify potential binding sites

    • Use chromatin immunoprecipitation (ChIP) to confirm binding

    • Employ mutagenesis of predicted sites to verify functional importance

How can I distinguish between different folate transporter activities in complex biological systems?

Distinguishing between activities of different folate transporters presents significant methodological challenges. Researchers should implement the following strategies:

  • pH manipulation:

    • Exploit differential pH optima of transporters

    • RFC functions optimally at neutral pH, while PCFT and FolT-like transporters function best at acidic pH

    • Conduct parallel experiments at multiple pH values (e.g., pH 5.5 and pH 7.4)

  • Genetic approaches:

    • Use RNAi or CRISPR-Cas9 to specifically silence individual transporters

    • For folt-1 in C. elegans, researchers used RNAi to demonstrate its functional role in folate uptake

    • Generate knockout models to eliminate specific transporter activities

  • Selective inhibitors:

    • Utilize transporter-specific inhibitors when available

    • Sulfasalazine inhibits folt-1 with an apparent Ki of 0.13 mM

    • Some antifolates like PT523 and GW1843U89 are selective RFC substrates with no apparent PCFT transport activity

  • Substrate selectivity:

    • Employ substrates with differential affinities for specific transporters

    • Compare uptake of reduced folates versus folic acid

    • Analyze transport kinetics to differentiate between carriers

  • Heterologous expression systems:

    • Express individual transporters in cells with minimal endogenous activity

    • Compare transport characteristics with those in native tissues

What approaches should be used to investigate structure-function relationships in FolT proteins?

To elucidate structure-function relationships in FolT proteins, implement these methodological approaches:

  • Domain analysis through truncation and mutation:

    • Generate systematic truncations to identify essential regions

    • Studies with folt-1 showed that the COOH-terminal and last transmembrane domain are not essential for transport function

    • Create chimeric proteins by swapping domains between different transporters

  • Site-directed mutagenesis:

    • Target conserved residues for mutagenesis

    • Focus on charged residues that may participate in substrate binding or proton coupling

    • Analyze effects on transport kinetics, substrate specificity, and pH dependence

  • Cysteine accessibility studies:

    • Introduce cysteine residues at specific positions

    • Use membrane-impermeable sulfhydryl reagents to probe accessibility

    • Map accessible regions to develop topological models

  • Homology modeling and molecular dynamics:

    • Generate structural models based on related transporters

    • Predict substrate binding sites and conformational changes

    • Validate predictions through experimental approaches

  • Cross-linking studies:

    • Use bifunctional cross-linking agents to identify interacting domains

    • Analyze oligomeric states and potential protein-protein interactions

    • Identify residues in close proximity during transport cycle

How should factorial experimental designs be implemented to study FolT interactions with other factors?

Factorial designs provide powerful approaches for investigating how FolT function is influenced by multiple factors. Implement the following methodological considerations:

  • Basic factorial design structure:

    • Use a 2×2 design to study interactions between two factors (e.g., FolT expression and pH)

    • Ensure balanced designs with equal observations in each condition

    • Consider higher-order designs for more complex interactions

  • Statistical power considerations:

    • Power the study appropriately for interaction tests, which typically require larger sample sizes

    • In many situations, the power for an interaction test is much lower than the power for main effects

    • When the interaction term is of major interest, the study should be powered to test the interaction

  • Model specification and analysis:

    • Include interaction terms in statistical models

    • Be cautious about removing interaction effects from models as this effectively accepts the null hypothesis

    • Interpret main effects in the context of identified interactions

  • Experimental applications:

    • Investigate interactions between FolT expression and environmental conditions

    • Study how genetic backgrounds modify FolT function

    • Examine how FolT activity interacts with other transport systems

  • Advanced design considerations:

    • For repeated measures, consider Balaam designs which yield treatment effect estimates unbiased by period-by-treatment effects

    • When appropriate, use crossover designs to reduce variability

What protocols should be followed for measuring folate uptake in FolT expression systems?

For reliable measurement of folate uptake in FolT expression systems, implement these methodological protocols:

  • Radiolabeled substrate preparation:

    • Use [³H]folic acid at appropriate specific activity

    • Prepare fresh substrate solutions for each experiment

    • Determine optimal substrate concentration based on transporter Km (e.g., 1.23 μM for folt-1)

  • Uptake assay conditions:

    • Optimize buffer composition and pH (typically acidic for FolT transporters)

    • Control temperature throughout the assay (usually 37°C for mammalian systems)

    • Establish linear uptake conditions through time course experiments

    • For C. elegans folt-1, uptake was linear for up to 20 minutes

  • Termination and processing:

    • Stop uptake by rapid washing with ice-cold buffer

    • For adherent cells, perform multiple washes to remove unbound substrate

    • Lyse cells with appropriate solubilization buffers

    • Measure radioactivity using liquid scintillation counting

  • Controls and normalization:

    • Include vector-only transfected cells as negative controls

    • Measure uptake of unrelated compounds (e.g., ascorbic acid) to confirm specificity

    • Normalize uptake to protein content or cell number

    • In folt-1 studies, ascorbic acid uptake served as a control to demonstrate transporter specificity

  • Kinetic analysis:

    • Measure uptake across a range of substrate concentrations

    • Calculate Km and Vmax using appropriate curve-fitting software

    • Determine inhibition constants (Ki) for various compounds

What gene silencing approaches are most effective for studying FolT function in different model systems?

Several gene silencing approaches can be effectively employed to study FolT function:

  • RNA interference (RNAi):

    • Design considerations:

      • Target unique regions of the FolT gene

      • Avoid sequences with off-target complementarity

      • Include positive and negative controls

    • Delivery methods:

      • For C. elegans, feeding RNAi (bacteria expressing dsRNA) is effective

      • In folt-1 studies, C. elegans were fed with E. coli expressing folt-1 RNAi plasmids

      • For mammalian cells, consider transfection or viral delivery of siRNA/shRNA

    • Validation:

      • Confirm knockdown efficiency by real-time PCR

      • Folt-1 RNAi in C. elegans showed significant reduction in mRNA levels

      • Assess functional consequences through folate uptake assays

  • CRISPR-Cas9 genome editing:

    • Design parameters:

      • Select guide RNAs with high on-target and low off-target scores

      • Consider frameshift mutations or deletion of critical domains

      • Plan screening strategies for edited clones

    • Delivery and selection:

      • Optimize transfection or electroporation conditions

      • Use appropriate selection markers

      • Screen clones by sequencing and expression analysis

    • Functional analysis:

      • Compare folate uptake in wildtype and knockout models

      • Assess phenotypic consequences of FolT loss

      • Perform rescue experiments with wildtype or mutant constructs

  • Morpholino antisense oligonucleotides (for developmental studies):

    • Design morpholinos targeting translation start sites or splice junctions

    • Validate specificity with rescue experiments

    • Monitor development and folate uptake in morphant embryos

How can in vivo imaging techniques be optimized for studying FolT expression and activity?

In vivo imaging provides valuable insights into FolT expression patterns and activity. Optimize these approaches:

  • Transcriptional fusion constructs:

    • Design parameters:

      • Clone the entire 5'-regulatory region of FolT genes

      • For folt-1, a 1.4 kb 5'-regulatory region was used

      • Ensure inclusion of all relevant regulatory elements

    • Reporter selection:

      • Use GFP for standard fluorescence microscopy

      • Consider spectral variants for co-localization studies

      • For quantitative studies, use destabilized variants to capture dynamic changes

    • Expression analysis:

      • Document expression in different tissues and developmental stages

      • For folt-1::GFP, expression was highest in the pharynx and intestine

      • Quantify fluorescence intensities under standardized conditions

  • Translational fusion proteins:

    • Construct design:

      • Fuse fluorescent proteins to N- or C-terminus of FolT

      • Consider the impact of tags on transporter function

      • Include flexible linkers to minimize functional disruption

    • Subcellular localization:

      • Use confocal microscopy for high-resolution imaging

      • Employ membrane markers for co-localization studies

      • Analyze trafficking dynamics using photoactivatable variants

  • Fluorescent folate analogs:

    • Utilize fluorescein-conjugated folates for transport visualization

    • Optimize imaging parameters for sensitivity and specificity

    • Perform competition studies with unlabeled folates

  • Quantitative analysis:

    • Standardize image acquisition parameters

    • Perform quantitative measurements using appropriate software

    • For folt-1::GFP, researchers measured fluorescence at multiple intestinal regions with fixed exposure times

What are the most effective approaches for studying the pH-dependence of FolT transport activity?

The pH-dependence of FolT transporters is a critical functional characteristic that requires specific methodological approaches:

  • Buffer system optimization:

    • pH range coverage:

      • Use buffers that maintain stable pH across the range of interest (typically pH 5.0-7.5)

      • MES buffer for pH 5.0-6.5, HEPES for pH 6.8-7.5

      • Ensure consistent ionic strength across pH values

    • Buffer composition:

      • Control for potential buffer effects on transporter function

      • Include appropriate salts to maintain physiological ionic conditions

      • Consider the impact of divalent cations (Ca²⁺, Mg²⁺)

  • Experimental design:

    • Measure transport activity across a comprehensive pH range (0.2-0.5 pH unit intervals)

    • Pre-equilibrate cells or membrane preparations at each pH

    • Maintain consistent temperature throughout experiments

    • Include pH measurements before and after uptake experiments

  • Kinetic analysis at different pH values:

    • Determine Km and Vmax at multiple pH points

    • Plot pH profiles to identify optimal transport conditions

    • Analyze the relationship between pH and substrate affinity

  • Proton coupling mechanisms:

    • Investigate proton gradient effects on transport directionality

    • Use ionophores to dissipate proton gradients

    • Measure intracellular pH during transport using fluorescent indicators

  • Structural determinants of pH sensitivity:

    • Identify potential proton-binding residues through mutagenesis

    • Focus on histidine, aspartate, and glutamate residues

    • Analyze the effects of mutations on pH sensitivity profiles

How should knockdown/knockout models be validated when studying FolT function?

Rigorous validation of knockdown or knockout models is essential for reliable interpretation of FolT functional studies:

  • Expression validation:

    • mRNA level assessment:

      • Use real-time PCR to quantify transcript levels

      • Design primers specific to the targeted FolT gene

      • In folt-1 RNAi studies, significant reduction in mRNA levels was confirmed

    • Protein level verification:

      • Use Western blotting when antibodies are available

      • Consider epitope-tagged constructs for detection

      • Examine membrane fractions for transporter expression

  • Specificity controls:

    • Off-target effects:

      • Monitor expression of related transporters

      • Check housekeeping genes (e.g., β-actin showed no change in folt-1 RNAi)

      • Use scrambled RNAi or non-targeting CRISPR guides as controls

    • Rescue experiments:

      • Reintroduce wildtype FolT to confirm phenotype reversal

      • Use RNAi-resistant constructs when applicable

      • Consider structure-function studies with mutant constructs

  • Functional validation:

    • Transport assays:

      • Measure uptake of folate compounds

      • Silencing or knockout of folt-1 in C. elegans led to significant inhibition of folate uptake

      • Include unrelated substrates as specificity controls (e.g., ascorbic acid uptake was unaffected in folt-1 RNAi)

    • Phenotypic analysis:

      • Document growth or developmental consequences

      • Analyze folate-dependent metabolic pathways

      • Consider folate supplementation to rescue phenotypes

  • Temporal and spatial considerations:

    • Examine acute versus chronic effects of FolT loss

    • Analyze tissue-specific consequences using conditional approaches

    • Consider compensatory mechanisms that may emerge over time

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.