Recombinant Formosania lacustre ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Biological Role

ATP synthase subunit a (mt-atp6) is encoded by the mitochondrial MT-ATP6 gene. It forms part of the F<sub>O</sub> domain, which facilitates proton translocation across the mitochondrial inner membrane, driving ATP synthesis in the F<sub>1</sub> domain . Key functions include:

  • Proton channel activity: Enables proton flow to power ATP synthesis .

  • Structural stability: Stabilizes interactions between the c-ring rotor and peripheral stalk subunits .

Research Applications

Recombinant mt-atp6 is used in:

  • Mechanistic studies: Elucidating rotary catalysis and proton transport in ATP synthase .

  • Disease modeling: Investigating mutations linked to mitochondrial disorders (e.g., neuropathy, ataxia) .

  • Drug discovery: Screening inhibitors targeting ATP synthase’s membrane domain .

Challenges and Limitations

  • Species-specific variability: Formosania lacustre mt-atp6 may have unique structural adaptations compared to mammals .

  • Expression hurdles: Membrane protein insolubility complicates purification .

Future Directions

  • Cryo-EM studies: High-resolution structural analysis of Formosania lacustre mt-atp6 in native lipid environments.

  • Functional assays: Proton translocation efficiency measurements using reconstituted proteoliposomes .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development to meet your specification.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Formosania lacustris (Oriental stream loach) (Crossostoma lacustre)
Target Names
Target Protein Sequence
MAMSFFDQFASPSYLGIPLIAIAIALPWVLFPLPSLRWVNNRLITIQGWLINRFTNQLML PLNTGGHKWALLLASLMVFLITINMLGLLPYTFTPTTQLSLNMGLAIPLWLATVIIGLRN QPTVALGDLLPEGTPLPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVF VLLPMMPTVAILTATVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using a proton gradient across the mitochondrial membrane. This gradient is generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: F1, containing the extramembraneous catalytic core; and F0, encompassing the membrane proton channel. These domains are linked via a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ATP synthase subunit a in Formosania lacustre compared to other species?

ATP synthase subunit a (mt-atp6) forms a critical component of the F-type ATP synthase complex, specifically within the membrane-embedded FO sector. While specific structural details for Formosania lacustre remain to be fully characterized, comparative studies across species reveal extreme sequence diversification despite conservation of essential structural features.

In apicomplexan parasites like Toxoplasma gondii, researchers have identified novel subunits through proteomic analysis of partially purified monomeric (~600 kDa) and dimeric (>1 MDa) forms of ATP synthase . Despite sequence divergence, key FO subunits including subunit a maintain recognizable structural features that allow for their identification .

It's noteworthy that subunit a is one of the few ATP synthase components encoded by mitochondrial DNA rather than nuclear DNA, which has implications for evolutionary studies and genetic analysis. The precise structure of F. lacustre mt-atp6 would likely show species-specific adaptations while maintaining the core structural elements necessary for proton translocation and ATP synthesis.

How does the mt-atp6 subunit contribute to ATP synthase function?

The mt-atp6 subunit serves a critical role in the proton translocation mechanism that drives ATP synthesis. Specifically:

  • It forms part of the proton channel through the inner mitochondrial membrane

  • It coordinates with the c-ring rotor in the FO sector to couple proton movement to rotary motion

  • It contains essential residues that facilitate proton transfer across the membrane

Biochemical studies across species have demonstrated that mutations in mt-atp6 can disrupt this process in various ways. For instance, specific variants can result in:

  • Decreased ATP synthesis while maintaining normal ATP hydrolysis capacity

  • Abnormal mitochondrial membrane potential (either increased or decreased)

  • Impaired proton pumping efficiency with otherwise normal holocomplex formation

For researchers working with F. lacustre mt-atp6, understanding these functional properties is essential for interpreting experimental results and designing appropriate assays to measure ATP synthase activity.

What evolutionary insights can be gained from studying F. lacustre mt-atp6?

Evolutionary analysis of mt-atp6 can reveal important adaptations in energy metabolism across different environmental niches. The extreme sequence diversification observed in ATP synthase subunits across species, despite functional conservation, suggests strong selective pressures driving adaptive evolution .

In apicomplexan parasites, researchers have observed that orthologs of key F-type ATP synthase subunits are restricted to apicomplexan, chromerid, and dinoflagellate species, with notable absence in ciliates. This indicates a major divergence in ATP synthase composition within the alveolate clade . Similar comparative analysis involving F. lacustre could reveal unique adaptations specific to its aquatic environment and evolutionary history.

Such evolutionary studies can provide insights into:

  • Metabolic adaptations to different environmental conditions

  • Molecular mechanisms of species divergence

  • Potential targets for species-specific inhibitors or modulators

What are the optimal methods for isolating intact ATP synthase from F. lacustre tissues?

Based on approaches used with other organisms, isolation of intact ATP synthase from F. lacustre would likely involve:

  • Tissue homogenization in appropriate buffer conditions that preserve complex integrity

  • Differential centrifugation to isolate mitochondria

  • Solubilization of mitochondrial membranes using mild detergents (e.g., digitonin or n-dodecyl β-D-maltoside)

  • Density gradient centrifugation or chromatographic methods for purification

  • Verification of complex integrity through Blue Native PAGE (BN-PAGE) analysis

For T. gondii, researchers successfully used partial purification followed by mass spectrometry analysis to identify the complete subunit composition of ATP synthase . Similar approaches could be adapted for F. lacustre, with appropriate modifications for tissue-specific considerations.

Researchers should be aware that the isolation conditions (particularly detergent type and concentration) can significantly impact the stability of the complex and the retention of loosely associated subunits.

How can researchers effectively assess ATP synthesis capacity in studies of recombinant mt-atp6?

Assessment of ATP synthesis capacity requires multiple complementary approaches:

  • Direct measurement of ATP production rates: Using luciferase-based assays to measure ATP synthesis in isolated mitochondria or submitochondrial particles in response to different substrates.

  • Measurement of mitochondrial membrane potential: Using fluorescent dyes like TMRM or JC-1 to assess the proton gradient that drives ATP synthesis.

  • Analysis of complex assembly and stability: Through techniques like BN-PAGE coupled with in-gel activity assays .

  • Respirometry: Using platforms like Seahorse or Oroboros to measure oxygen consumption rates linked to ATP production.

Based on studies of MT-ATP6 variants, researchers should note that different mutations can affect these parameters in distinct ways. The following table summarizes patterns observed with known mt-atp6 variants:

MutationATP SynthesisATP HydrolysisMembrane PotentialMechanism
m.8993T>GDecreased (36/38 cases)Normal (19/22 cases)Increased (7/8 cases)Abnormal proton translocation without rotor rotation
m.8993T>CDecreased (8/12 cases)Normal (6/6 cases)VariablePartial reduction of ATP synthesis
m.9176T>GDecreased with malateNormalIncreasedImpaired proton pumping efficiency
m.9185T>CNormal (1/1 cases)Decreased (3/5 cases)Decreased (3/3 cases)Impairment of proton pump

These patterns highlight the importance of conducting multiple assays to fully characterize the functional impact of mt-atp6 modifications.

What techniques are most reliable for assessing the assembly of F-type ATP synthase complex?

Several complementary techniques provide insights into ATP synthase assembly:

  • Blue Native PAGE (BN-PAGE): This allows visualization of intact ATP synthase complexes and can detect assembly defects. Studies in plants have shown that knockdown of ATP synthase subunits results in decreased F1FO complex bands with preserved activity of other respiratory complexes .

  • In-gel activity assays: These can assess the hydrolytic activity of assembled ATP synthase complexes. Reduced ATPase hydrolysis activity has been observed in plants with decreased expression of ATP synthase subunits .

  • Immunoblotting with subunit-specific antibodies: This can detect changes in the abundance of individual subunits and subcomplexes.

  • Proteomic analysis: Quantitative proteomics can reveal changes in the abundance of ATP synthase subunits and associated proteins. In plants with reduced ATP synthase subunit d, most other ATP synthase subunits were also significantly downregulated .

  • Electron microscopy: This can visualize ATP synthase dimers and their organization into rows at cristae edges.

Researchers should be aware that assembly defects may not always correlate directly with functional deficits, as some variants can form structurally intact but functionally impaired complexes.

How should researchers approach heteroplasmy analysis in mt-atp6 studies?

Heteroplasmy—the presence of mixed populations of wild-type and variant mitochondrial DNA—is a critical consideration in mt-atp6 research. Evidence from human studies indicates that heteroplasmy levels strongly correlate with clinical manifestations of MT-ATP6 variants .

For F. lacustre studies, researchers should:

  • Quantify heteroplasmy accurately: Use methods such as next-generation sequencing, digital PCR, or pyrosequencing that provide precise quantification.

  • Analyze tissue-specific heteroplasmy: Different tissues may show varying levels of heteroplasmy. In human studies, significant differences have been observed between blood, muscle, and fibroblast samples .

  • Consider threshold effects: Evidence suggests symptomatic individuals with MT-ATP6 variants have significantly higher heteroplasmy load (p=1.6×10^-39) . This indicates potential threshold effects where symptoms manifest only above certain heteroplasmy levels.

  • Isolate cell populations with different heteroplasmy levels: Research has shown that homoplasmic cells can exhibit significantly decreased mitochondrial respiration capacity compared to cells with lower heteroplasmy or healthy controls .

  • Perform segregation analysis: Tracking heteroplasmy across generations can provide insights into inheritance patterns and potential selection pressures .

These approaches will help researchers establish meaningful correlations between heteroplasmy levels and biochemical/functional outcomes in their studies.

What are the common biochemical consequences of mt-atp6 variants?

Studies of human MT-ATP6 variants have revealed diverse biochemical consequences that researchers studying F. lacustre should consider:

This biochemical heterogeneity highlights the importance of comprehensive functional characterization rather than relying on single assays when studying novel mt-atp6 variants or modifications.

What are the most informative experimental controls for mt-atp6 research?

Robust experimental design for F. lacustre mt-atp6 research should include:

  • Wild-type controls: Unmodified F. lacustre ATP synthase provides the baseline for comparison.

  • Heteroplasmy controls: When studying variants, include samples with different heteroplasmy levels to establish dose-response relationships.

  • Tissue-matched controls: Different tissues may show distinct ATP synthase characteristics or responses to modification.

  • Functional recovery controls: Complementation with wild-type mt-atp6 can confirm that observed defects are specifically due to mt-atp6 modification.

  • Pharmacological controls: Specific inhibitors (e.g., oligomycin for ATP synthase, FCCP for membrane potential) help validate assay specificity.

In cell-based studies, creating homoplasmic cell lines through single-cell sorting techniques can provide valuable experimental models, as demonstrated in studies of human MT-ATP6 variants .

How can structural information about mt-atp6 inform the development of species-specific modulators?

The structural diversity of ATP synthase subunits across species presents opportunities for developing highly specific modulators or inhibitors. For researchers investigating F. lacustre mt-atp6:

  • Identifying unique structural features or residues in the proton channel could enable design of compounds that selectively interact with F. lacustre ATP synthase.

  • Comparative structural analysis across related species can reveal conserved vs. divergent regions that might serve as targets for selective modulation.

  • Molecular docking studies using homology models can predict binding interactions of potential modulators.

This approach has been suggested for developing antiparasitic agents targeting the highly diverged ATP synthase in apicomplexan parasites . Similar principles could apply to developing research tools for selective modulation of F. lacustre ATP synthase.

What computational approaches can effectively model mt-atp6 function?

Advanced computational methods can provide insights into mt-atp6 function that complement experimental approaches:

  • Molecular dynamics simulations: These can model proton movement through the FO sector and predict how specific residues contribute to the process.

  • Homology modeling: For species like F. lacustre where structural data may be limited, models based on better-characterized homologs can predict structure-function relationships.

  • Systems biology approaches: These can integrate ATP synthase function into broader metabolic networks to predict systemic effects of mt-atp6 modifications.

  • Quantum mechanical/molecular mechanical (QM/MM) calculations: These can provide detailed insights into the energetics of proton transfer events.

Such computational approaches are particularly valuable for studying variants like m.8993T>G, where abnormal salt bridge formation between subunits a and c is proposed to prevent rotor rotation after proton translocation .

What are the key experimental challenges in expressing recombinant mt-atp6?

Researchers working with recombinant F. lacustre mt-atp6 face several challenges:

  • Mitochondrial genetic code differences: Mt-atp6 is encoded in mitochondrial DNA, which may use a different genetic code than nuclear DNA, necessitating codon optimization for expression in heterologous systems.

  • Hydrophobicity: As a membrane protein, mt-atp6 is highly hydrophobic and may form inclusion bodies when overexpressed.

  • Complex assembly requirements: Proper folding and function likely depend on interactions with other ATP synthase subunits.

  • Post-translational modifications: Any species-specific modifications required for function may be absent in heterologous systems.

Potential strategies to address these challenges include:

  • Using specialized expression systems designed for membrane proteins

  • Co-expressing multiple ATP synthase subunits simultaneously

  • Employing detergents or amphipols to stabilize the isolated protein

  • Creating fusion constructs with solubility-enhancing partners

How might environmental adaptations be reflected in F. lacustre mt-atp6 structure and function?

As an aquatic species, F. lacustre likely exhibits adaptations in energy metabolism that reflect its environmental niche. Future research directions could explore:

  • Temperature adaptations: How the thermal stability and activity of ATP synthase correlate with the temperature range of F. lacustre's habitat.

  • Metabolic rate adjustments: Whether specific features of mt-atp6 contribute to regulating ATP synthesis rates in response to environmental conditions.

  • Stress responses: How ATP synthase function adjusts during environmental stressors such as hypoxia or temperature fluctuations.

Studies in plants have demonstrated that ATP synthase function is critical for stress tolerance, particularly heat stress . Similar investigations in F. lacustre could reveal important adaptations specific to aquatic environments.

What are the implications of mt-atp6 research for understanding mitochondrial disease mechanisms?

Research on F. lacustre mt-atp6 could contribute to broader understanding of mitochondrial disease mechanisms:

  • Studies of naturally occurring variants might reveal compensatory mechanisms that mitigate potential functional deficits.

  • Comparative analysis across species could identify conserved pathogenic mechanisms associated with specific structural changes.

  • The study of heteroplasmy and its functional consequences in different tissues could inform understanding of the tissue-specific manifestations of mitochondrial diseases.

Human MT-ATP6 variants are associated with diverse clinical presentations, from severe Leigh syndrome to milder phenotypes including Leber's hereditary optic neuropathy-like optic atrophy . Understanding the molecular basis of this phenotypic diversity requires integrating insights from multiple model systems, potentially including F. lacustre.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.