Recombinant Formosania lacustre Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Formosania lacustre Cytochrome c oxidase subunit 2 (mt-co2) is a cloned variant of the second subunit of cytochrome c oxidase (COX2), encoded by the mitochondrial MT-CO2 gene in Formosania lacustre (Oriental stream loach). This protein is integral to Complex IV of the electron transport chain (ETC), where it facilitates electron transfer from cytochrome c to molecular oxygen via its binuclear copper A (CuA) center .

Key AttributesDetails
SpeciesFormosania lacustre (Oriental stream loach)
UniProt IDP34189
Protein Length230 amino acids (full-length)
Molecular Weight~25–27 kDa (theoretical)
Expression SystemRecombinant production in E. coli (commonly used for mitochondrial proteins due to codon compatibility)
TagVariable (determined during production; commonly His-tag for purification)

Domain Architecture

  • Transmembrane Regions: Two α-helical segments (residues 15–45 and 60–87) anchor the protein to the mitochondrial inner membrane .

  • CuA Center: A conserved cysteine loop (residues 196–200) and histidine 204 coordinate the copper ions required for electron transfer .

  • Periplasmic Domain: Exposed to the intermembrane space, enabling interaction with cytochrome c .

Sequence Highlights

The amino acid sequence (MAHPTQLGFQDAASPVMEELLHFHDHALMIVFLISALVLYVIITTVSTKLTNMYILDSQE...) includes:

  • Electron Transfer Residues: Glutamate 129, aspartate 132, and glutamate 19 form a lysine ring for cytochrome c binding .

  • Post-Translational Modifications: Bacterial COX2 homologs may include a C-terminal haem c attachment, though this is absent in Formosania lacustre .

Recombinant Production and Purification

Commercial and research-grade recombinant mt-co2 is produced using standardized protocols:

Expression and Purification Workflow

StepDetails
CloningMT-CO2 gene amplified from mitochondrial DNA and inserted into a plasmid .
ExpressionInduced in E. coli with IPTG; optimized for soluble protein yield .
PurificationAffinity chromatography (e.g., Ni-NTA for His-tagged variants) .
StorageTris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Quality Control

  • Purity: >90% verified by SDS-PAGE .

  • Activity: Validated via cytochrome c oxidation assays (not directly reported for Formosania lacustre but inferred from human homologs ).

Research Applications

Recombinant mt-co2 serves multiple experimental purposes:

Functional Studies

  • Electron Transport Chain Analysis: Used to investigate evolutionary conservation of COX2 mechanisms across species .

  • Enzyme Kinetics: Measures oxygen reduction rates in synthetic mitochondrial systems .

Disease Modeling

While Formosania lacustre COX2 is not directly linked to human diseases, its structural similarity to human COX2 (73% sequence identity) supports studies on:

  • Mitochondrial Disorders: e.g., Leigh syndrome and Complex IV deficiency caused by MT-CO2 mutations .

  • Drug Screening: Evaluates inhibitors targeting the CuA center .

Limitations and Future Directions

  • Species-Specific Variability: Functional differences between fish and mammalian COX2 may limit translational relevance .

  • Structural Data Gaps: No crystallography data exists for Formosania lacustre COX2; homology modeling relies on human/bacterial structures .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag type.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Formosania lacustris (Oriental stream loach) (Crossostoma lacustre)
Target Names
Target Protein Sequence
MAHPTQLGFQDAASPVMEELLHFHDHALMIVFLISALVLYVIITTVSTKLTNMYILDSQE IEIVWTVLPALILILIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYENLSFDS YMIPTQDLTPGQFRLLETDHRMVVPMESPIRILVSAEDVLHSWALPAMGVKMDAVPGRLN QTAFIASRPGVFYGQCSEICGANHSFMPIVVEAVPLSHFENWSTLMLKDA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to water using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Cytochrome c Oxidase Subunit 2 in Formosania lacustre?

Cytochrome c oxidase subunit 2 (COX2/mt-co2) in Formosania lacustre serves as a critical component of the mitochondrial respiratory chain. The protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase, which is crucial for the production of ATP during cellular respiration . This process involves the reduction of molecular oxygen to water, coupled with proton translocation across the inner mitochondrial membrane. In Formosania lacustre, as in other teleosts, the mt-co2 protein likely plays a key role in adapting to varying oxygen conditions in freshwater environments, though specific adaptation mechanisms may differ from those observed in marine species like Tigriopus californicus.

How conserved is the mt-co2 sequence across different fish species compared to Formosania lacustre?

While specific data for Formosania lacustre is limited in the provided search results, studies on other species indicate that COII genes typically show varying degrees of conservation. In Tigriopus californicus, for example, despite COII encoding a highly conserved protein critical for electron transport, researchers observed extensive intraspecific nucleotide and amino acid variation among sequences sampled from different populations . Interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions . We might expect Formosania lacustre to show similar patterns of conservation within populations but potential divergence between geographically isolated populations or closely related species. This pattern of conservation would reflect functional constraints on the protein while allowing for adaptation to local environmental conditions.

What are the primary challenges in expressing recombinant Formosania lacustre mt-co2 in bacterial systems?

Expression of recombinant mt-co2 from Formosania lacustre in bacterial systems presents several challenges:

  • Codon bias: Mitochondrial genes like mt-co2 often have different codon usage patterns compared to bacterial expression hosts, potentially leading to inefficient translation or premature termination.

  • Post-translational modifications: Bacterial systems may lack the machinery necessary for proper folding and modification of eukaryotic mitochondrial proteins.

  • Membrane protein expression: As mt-co2 is a membrane-associated protein, its hydrophobic regions can cause aggregation and toxicity in bacterial hosts.

  • Proper copper incorporation: COX2 proteins require copper cofactors for proper function, and bacterial expression systems may not efficiently incorporate these metal ions.

  • Protein stability: The protein may be unstable outside its native membrane environment, particularly at the higher temperatures (55°C) used for some bacterial expression systems .

Methods to address these challenges include codon optimization, using specialized bacterial strains, fusion with solubility-enhancing tags, and expression under controlled temperature and pH conditions similar to those observed in thermoacidophilic bacteria that naturally express oxygen-tolerant enzymes .

How do nonsynonymous substitutions in Formosania lacustre mt-co2 affect interactions with nuclear-encoded subunits of the cytochrome c oxidase complex?

Nonsynonymous substitutions in mt-co2 can significantly impact the interaction with nuclear-encoded subunits of the cytochrome c oxidase complex. Based on studies of similar systems, we can infer that such substitutions in Formosania lacustre mt-co2 likely influence:

  • Protein-protein interface stability: Amino acid changes at interaction surfaces may strengthen or weaken binding between mt-co2 and nuclear-encoded COX subunits.

  • Co-evolutionary dynamics: In species like Tigriopus californicus, interpopulation hybridization studies reveal that approximately 4% of the sites in COII appear to evolve under relaxed selective constraint (ω = 1), while some sites may experience positive selection . This suggests a co-evolutionary relationship between mt-co2 and its nuclear partners.

  • Functional consequences: Studies of interpopulation hybrids between different California Tigriopus populations showed functional and fitness consequences related to COII variation . Similar phenomena may occur in Formosania lacustre populations with divergent mt-co2 sequences.

  • Electron transfer efficiency: Substitutions near the copper-binding sites or in regions involved in electron transfer from cytochrome c could alter the efficiency of energy production.

Methodologically, investigating these interactions requires techniques such as yeast two-hybrid assays, co-immunoprecipitation studies, or reconstitution experiments using purified recombinant proteins to measure binding affinities and electron transfer rates under varying conditions.

What is the impact of environmental pH and temperature variations on the structure and function of recombinant Formosania lacustre mt-co2?

Environmental factors like pH and temperature significantly impact the structure and function of recombinant mt-co2 proteins. Based on studies of thermoacidophilic organisms:

ParameterOptimal RangeEffects Below OptimalEffects Above Optimal
pH5.0-7.0*Decreased stability, altered metal coordinationProtein denaturation, loss of copper ions
Temperature25-30°C*Reduced catalytic activityProtein unfolding, aggregation

*Estimated range for Formosania lacustre based on typical freshwater fish physiology

Research methodologies to assess these impacts include:

  • Circular dichroism spectroscopy to monitor secondary structure changes under varying conditions

  • Activity assays measuring electron transfer rates at different pH values and temperatures

  • Thermal shift assays to determine protein stability across temperature gradients

  • Molecular dynamics simulations to predict structural changes in response to environmental variations

For comparison, thermoacidophilic bacteria like Kyrpidia spormannii can thrive at temperatures around 55°C and pH 5.0, with specialized adaptations in their respiratory enzymes . Formosania lacustre, as a freshwater fish, would have evolved different adaptations for its typically cooler and more neutral pH environment, likely affecting the stability and activity profiles of its mt-co2 protein.

How can advanced computational modeling predict potential binding sites for small molecule modulators of Formosania lacustre mt-co2 activity?

Advanced computational approaches for predicting small molecule binding sites on Formosania lacustre mt-co2 involve multiple complementary methods:

  • Homology modeling: Since the crystal structure of Formosania lacustre mt-co2 may not be available, homology models can be constructed based on known structures of cytochrome c oxidase subunit 2 from other species, particularly other teleosts.

  • Molecular docking simulations: Programs like AutoDock Vina, GOLD, or Glide can be used to identify potential binding pockets and predict binding poses of small molecules.

  • Molecular dynamics (MD) simulations: MD can reveal dynamic binding site conformations not evident in static structures, particularly important for membrane proteins like mt-co2.

  • Machine learning approaches: Neural networks trained on known protein-ligand interactions can predict novel binding sites and even suggest chemical scaffolds for potential modulators.

  • Quantum mechanical calculations: For predicting interactions with the metal centers (copper sites) in mt-co2, QM/MM hybrid methods provide more accurate modeling of metal-ligand coordination.

These computational predictions must be validated experimentally through site-directed mutagenesis, binding assays, and functional studies measuring changes in electron transfer rates or oxygen consumption in the presence of predicted modulators.

What are the optimal expression systems for producing functional recombinant Formosania lacustre mt-co2?

The choice of expression system for functional recombinant Formosania lacustre mt-co2 depends on research objectives and downstream applications:

Expression SystemAdvantagesDisadvantagesRecommended For
E. coliRapid growth, high yields, low costLimited post-translational modifications, inclusion body formationInitial structural studies, antibody production
Yeast (S. cerevisiae, P. pastoris)Eukaryotic PTMs, membrane protein machineryLonger cultivation time, complex media requirementsFunctional studies requiring proper folding and PTMs
Insect cellsComplex eukaryotic PTMs, good for membrane proteinsExpensive, technically demandingHigh-resolution structural studies, interaction analyses
Mammalian cellsNative-like folding and PTMsHighest cost, lowest yieldsStudies requiring mammalian-like glycosylation

Methodological optimization strategies include:

  • Codon optimization: Adapt the mt-co2 gene sequence to match the codon bias of the chosen expression host.

  • Fusion tags: N- or C-terminal tags (His, GST, MBP) can improve solubility and facilitate purification, though they may need removal for functional studies.

  • Expression conditions: Optimizing temperature (typically lowered to 15-20°C during induction), inducer concentration, and growth phase can significantly improve yields of functional protein.

  • Membrane mimetics: For functional studies, the purified protein should be reconstituted in appropriate membrane mimetics (nanodiscs, liposomes, or detergent micelles) that resemble the native mitochondrial membrane environment.

  • Co-expression strategies: Co-expressing chaperones or partner proteins from the COX complex may improve folding and stability.

What are the most effective protocols for analyzing the electron transfer kinetics of recombinant Formosania lacustre mt-co2?

Analyzing electron transfer kinetics of recombinant Formosania lacustre mt-co2 requires specialized approaches to capture the rapid electron movement through the protein:

  • Stopped-flow spectroscopy: This technique allows measurement of reaction kinetics on the millisecond timescale by rapidly mixing oxidized cytochrome c with recombinant mt-co2 and monitoring spectral changes.

  • Oxygen consumption assays: Polarographic methods using Clark-type electrodes can measure oxygen reduction rates catalyzed by reconstituted COX complexes containing recombinant mt-co2.

  • Membrane-Inlet Mass Spectrometry (MIMS): Similar to techniques used to study H₂ consumption kinetics in Kyrpidia spormannii , MIMS can provide real-time monitoring of gas exchange during electron transfer reactions.

  • Electron paramagnetic resonance (EPR): This technique can track changes in the oxidation state of the copper centers in mt-co2 during electron transfer.

  • Electrochemical methods: Protein film voltammetry on modified electrodes can directly measure electron transfer rates under varying potentials.

Data analysis requires fitting to appropriate kinetic models, typically using Michaelis-Menten kinetics or more complex models that account for the multiple electron transfers in the complete COX cycle. Parameters typically measured include kcat (turnover number), KM (Michaelis constant for cytochrome c), and electron transfer rates between specific redox centers.

How can site-directed mutagenesis be optimized to study structure-function relationships in recombinant Formosania lacustre mt-co2?

Optimized site-directed mutagenesis approaches for studying structure-function relationships in recombinant Formosania lacustre mt-co2 include:

  • Rational design based on comparative analysis: Compare mt-co2 sequences across related species to identify conserved versus variable residues. Studies of Tigriopus californicus COII showed that the majority of codons are under strong purifying selection (ω << 1), while approximately 4% of sites evolve under relaxed selective constraint (ω = 1) . This information can guide selection of residues for mutagenesis.

  • Targeting functional domains:

    • Cytochrome c binding interface

    • Copper coordination sites

    • Proton channels

    • Interfaces with other COX subunits

  • Mutagenesis techniques:

    • QuikChange PCR for single mutations

    • Gibson Assembly for multiple simultaneous mutations

    • Golden Gate Assembly for combinatorial mutagenesis libraries

  • Functional assessment protocols:

    • Oxygen consumption assays comparing wild-type and mutant proteins

    • Binding affinity measurements with partner proteins

    • Thermal stability comparisons

    • Electron transfer rate determinations

  • Data interpretation frameworks:

    • ΔΔG calculations for stability changes

    • Molecular dynamics simulations of mutant structures

    • Statistical coupling analysis to identify co-evolving residues

By systematically mutating specific residues and measuring the resulting functional changes, researchers can map the relationship between sequence, structure, and function in Formosania lacustre mt-co2, particularly focusing on regions that may have evolved under positive selection to compensate for amino acid substitutions in other subunits .

What are the major technical barriers in studying interactions between recombinant Formosania lacustre mt-co2 and nuclear-encoded COX subunits?

Several technical barriers complicate the study of interactions between recombinant Formosania lacustre mt-co2 and nuclear-encoded COX subunits:

  • Membrane protein reconstitution: Achieving proper orientation and stoichiometry of multiple membrane proteins in artificial systems remains challenging.

  • Component availability: Expressing and purifying all interacting components of the COX complex in functional form requires extensive optimization.

  • Complex assembly: The assembly process of the complete COX complex involves numerous chaperones and assembly factors that may be species-specific.

  • Measuring weak transient interactions: Some of the interactions within the COX complex may be transient or dependent on the membrane environment, making them difficult to capture with standard techniques.

  • Species-specific factors: The co-evolution of mitochondrial and nuclear genomes means that interactions may be highly species-specific, complicating the use of heterologous systems.

Innovative approaches to overcome these barriers include:

  • Native nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain the membrane environment

  • Cell-free expression systems allowing simultaneous synthesis of multiple components

  • Advanced cryo-EM techniques for structural determination of membrane protein complexes

  • Split fluorescent or luminescent reporters to visualize protein-protein interactions in living cells

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

How can cutting-edge mass spectrometry techniques improve our understanding of post-translational modifications in Formosania lacustre mt-co2?

Advanced mass spectrometry techniques offer powerful approaches for characterizing post-translational modifications (PTMs) in Formosania lacustre mt-co2:

  • Top-down proteomics: Analyzing intact mt-co2 protein can preserve labile PTMs and reveal their combinations and stoichiometry.

  • Multiple reaction monitoring (MRM): This targeted approach allows quantification of specific modified peptides with high sensitivity.

  • Cross-linking mass spectrometry (XL-MS): By chemically cross-linking mt-co2 with interacting proteins before digestion and MS analysis, researchers can map interaction interfaces and how PTMs affect these interactions.

  • Hydrogen-deuterium exchange MS (HDX-MS): This technique reveals structural dynamics and how PTMs alter protein conformation and flexibility.

  • Glycoproteomics approaches: Specialized fragmentation methods like electron transfer dissociation (ETD) preserve glycan structures while providing peptide sequence information.

The workflow typically involves:

  • Enrichment of modified peptides using affinity techniques

  • LC-MS/MS analysis with optimized fragmentation methods

  • Database searching with appropriate modification parameters

  • Site localization scoring to determine exact modification sites

  • Quantitative analysis to determine modification stoichiometry

These techniques can reveal how PTMs like phosphorylation, acetylation, or oxidative modifications affect the function and interactions of Formosania lacustre mt-co2, potentially providing insights into regulatory mechanisms and adaptation strategies.

What potential applications exist for using recombinant Formosania lacustre mt-co2 as a model for studying mitochondrial dysfunction in metabolic diseases?

Recombinant Formosania lacustre mt-co2 offers several advantages as a model for studying mitochondrial dysfunction in metabolic diseases:

  • Evolutionary insights: As a freshwater fish, Formosania lacustre represents an interesting evolutionary position for comparative studies with mammalian systems, potentially revealing conserved mechanisms of mitochondrial function and dysfunction.

  • Environmental adaptation: Fish species often exhibit adaptations to varying oxygen levels, temperature, and pH, making their mitochondrial proteins potentially more robust to stressors relevant to disease states.

  • Specific research applications:

    • Creating mutation libraries: Introducing disease-associated mutations found in human mt-co2 into the Formosania lacustre protein to study functional impacts

    • Developing high-throughput screens: Using recombinant mt-co2 in assay systems to screen for compounds that rescue dysfunction

    • Studying mitonuclear compatibility: Investigating how mismatches between mitochondrial and nuclear components affect respiratory function

    • Modeling environmental stressors: Examining how temperature, pH, and oxidative stress affect mt-co2 function and stability

  • Methodological approaches:

    • Reconstitution of hybrid complexes containing components from both fish and mammalian systems

    • CRISPR-Cas9 editing of cellular models to introduce Formosania lacustre mt-co2 variants

    • Computational modeling comparing the effects of mutations across species

    • Microfluidic systems for parallel testing of multiple conditions and variants

This research could provide insights into conditions like mitochondrial myopathies, certain neurodegenerative disorders, and metabolic syndromes where cytochrome c oxidase dysfunction plays a role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.