Recombinant Formosania lacustre NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Expression System

  • Produced in yeast (Saccharomyces cerevisiae) for eukaryotic post-translational fidelity .

  • Purification typically achieves >85% purity via SDS-PAGE .

Functional and Mechanistic Insights

Recombinant MT-ND4L is used to study mitochondrial Complex I dysfunction, which is implicated in metabolic and neurodegenerative disorders. Key functional roles include:

  • Electron Transfer: Facilitates NADH oxidation and electron donation to ubiquinone, initiating proton gradient formation .

  • Pathogenic Relevance: Mutations in MT-ND4L homologs (e.g., human T10663C) disrupt ATP synthesis, leading to conditions like Leber’s Hereditary Optic Neuropathy (LHON) .

Research Applications

  • Metabolomic Studies: MT-ND4L variants correlate with glycerophospholipid metabolism disruptions, suggesting roles in obesity and diabetes .

  • Disease Modeling: Used to explore LHON pathogenesis and mitochondrial DNA (mtDNA) mutation thresholds .

Comparative Analysis with Human MT-ND4L

FeatureHuman MT-ND4LRecombinant F. lacustre MT-ND4L
Gene OverlapOverlaps with MT-ND4 in mitochondrial DNANo overlap reported
Clinical MutationsVal65Ala linked to LHON Not yet studied
Structural StudiesCore transmembrane subunit of Complex I Partial sequence limits structural analysis

Research Gaps and Future Directions

  • Functional Assays: Limited data exist on the recombinant protein’s enzymatic activity or interaction with other Complex I subunits.

  • Species-Specific Studies: Formosania lacustre MT-ND4L’s role in its native mitochondrial context remains uncharacterized.

  • Therapeutic Potential: No studies explore its utility in gene therapy for mitochondrial disorders.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for customers.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. For specific tag requirements, please inform us, and we will prioritize development based on your request.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Formosania lacustris (Oriental stream loach) (Crossostoma lacustre)
Target Names
Target Protein Sequence
MTPVHFSFTSAFILGLMGLAFYRTHLLSALLCLEGMMLSLFIALALWALQFESTGFSTAP MLLLAFSACEASAGPGLLVATARTHGTDRLQNLNLLQC
Uniprot No.

Target Background

Function
As a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), this protein is believed to be essential for catalytic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the presumed immediate electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of MT-ND4L in the mitochondrial respiratory chain?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a critical component of Complex I, the largest of the five complexes in the electron transport chain. This small but essential protein (approximately 11 kDa, composed of 98 amino acids in humans) is one of the core hydrophobic subunits that form the transmembrane domain of Complex I .

The protein functions in the first step of the electron transport process, facilitating the transfer of electrons from NADH to ubiquinone. This transfer establishes an electrochemical gradient across the inner mitochondrial membrane that powers ATP synthesis . The Formosania lacustre MT-ND4L specifically contains 116 amino acids and is characterized by high hydrophobicity with multiple transmembrane domains .

For researchers investigating this protein, it's important to note that MT-ND4L is not merely a passive component but plays an active role in Complex I assembly. Studies have demonstrated that absence of ND4L prevents the assembly of the complete 950-kDa Complex I and eliminates its enzymatic activity . This makes it a critical target for understanding mitochondrial dysfunction in various pathological conditions.

  • What genetic characteristics distinguish MT-ND4L from other mitochondrial genes?

MT-ND4L has several unique genetic characteristics that researchers should consider:

  • Gene location: In humans, MT-ND4L is located in mitochondrial DNA from base pair 10,469 to 10,765 .

  • Overlapping genes: An unusual feature of human MT-ND4L is its 7-nucleotide overlap with MT-ND4. The last three codons of MT-ND4L (5'-CAA TGC TAA-3' coding for Gln, Cys and Stop) overlap with the first three codons of MT-ND4 (5'-ATG CTA AAA-3') . This arrangement requires careful primer design when amplifying either gene.

  • Nuclear encoding in some species: While predominantly mitochondrially encoded, MT-ND4L is encoded in the nuclear genome in some organisms like the green alga Chlamydomonas reinhardtii. In such cases, the protein shows lower hydrophobicity compared to mitochondrially encoded counterparts, facilitating proper import into mitochondria .

  • Sequence conservation: MT-ND4L shows variable conservation patterns across species. When designing experiments involving recombinant proteins, researchers should consider these variations, especially in the context of heterologous expression systems.

  • How do variants in MT-ND4L contribute to disease phenotypes?

Variants in MT-ND4L have been associated with several pathological conditions:

  • Leber hereditary optic neuropathy (LHON): Mutations such as T10663C (Val65Ala) have been identified in patients with LHON .

  • Alzheimer's disease: A study analyzing 4,220 mtDNA variants revealed significant association between Alzheimer's disease and a rare MT-ND4L variant (rs28709356 C>T; minor allele frequency = 0.002; P = 7.3 × 10⁻⁵) .

  • High-altitude adaptation: Specific haplotypes in MT-ND4L (particularly haplotype Ha1) show positive associations with high-altitude adaptability in Tibetan yaks and cattle .

When investigating these variants, researchers should implement comprehensive approaches including:

  • Sequencing the entire MT-ND4L gene rather than targeted hotspot analysis

  • Assessing heteroplasmy levels (the proportion of mutant to wild-type mtDNA)

  • Validating findings in tissue-specific contexts, as mtDNA copy number and heteroplasmy vary across tissues

Advanced Research Questions

  • How does the absence of MT-ND4L affect Complex I assembly and function in different model systems?

The absence of MT-ND4L has profound effects on Complex I, as demonstrated in multiple experimental systems:

In Chlamydomonas reinhardtii, where MT-ND4L is nuclear-encoded:

  • RNA interference-mediated suppression of NUO11 (the nuclear gene encoding ND4L) prevented assembly of the entire 950-kDa Complex I

  • Enzymatic activity was completely abolished, demonstrating that ND4L is essential for both assembly and function

Similar observations have been made in mammalian systems using various approaches:

  • The absence of ND4L prevents formation of a functional enzyme complex

  • Even partial reduction in ND4L expression can lead to decreased electron transfer rates in complex I-dependent pathways

When designing experiments to investigate MT-ND4L's role:

  • Use blue-native gel electrophoresis (BNGE) to assess complex assembly

  • Measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria

  • Assess downstream effects on ATP production and oxygen consumption rates

  • Examine compensatory mechanisms that may be activated in response to Complex I dysfunction

  • What are the most effective approaches for creating and validating MT-ND4L knockout models?

Creating knockout models for mitochondrially encoded genes presents unique challenges. Recent technological advances have made this more feasible:

For mtDNA-encoded ND4L:

  • Base editors such as DdCBE (DddA-derived cytosine base editors) can be employed to introduce premature stop codons. For MT-ND4L specifically, researchers have designed constructs to change the coding sequence for Val90 and Gln91 (GTC CAA) into Val and STOP (GTT-TAA) .

  • Validation requires multiple approaches:

    • Sequencing to confirm the intended edit

    • Assessment of heteroplasmy level

    • Quantification of MT-ND4L protein by western blot

    • Functional assays (BNGE, Complex I activity measurements)

    • De novo protein synthesis assays to confirm absence of the protein

For nuclear-encoded ND4L (as in Chlamydomonas):

  • RNA interference has been successfully used to suppress expression

  • CRISPR-Cas9 approaches can be employed for complete gene knockout

When validating these models, researchers should examine:

  • Complex I assembly using BNGE

  • Electron transfer activity using biochemical assays

  • Cellular respiration measurements

  • Adaptive responses that may compensate for MT-ND4L absence

  • How can researchers accurately measure electron transfer properties of MT-ND4L in experimental systems?

Measuring the specific contribution of MT-ND4L to electron transfer requires sophisticated approaches:

In isolated mitochondria:

  • Measure rotenone-sensitive, ubiquinone-dependent electron transfer activity as demonstrated in studies of LHON mutations

  • Compare NADH dehydrogenase activity (proximal activity) with complete NADH:ubiquinone oxidoreductase activity to distinguish between partial and complete Complex I dysfunction

In intact cells:

  • Oxygen consumption rate measurements with substrate-specific inhibitors

  • NAD+/NADH ratio assessment to evaluate electron transfer efficiency

  • Membrane potential measurements to assess proton pumping activity

With purified recombinant protein:

  • Reconstitution experiments with other Complex I components

  • Direct measurement of electron transfer using artificial electron acceptors

When investigating specific mutations, researchers can compare:

  • Wild-type MT-ND4L

  • Disease-associated mutants

  • Species-specific variants

For example, the ND1/3460 mutation exhibits 80% reduction in rotenone-sensitive and ubiquinone-dependent electron transfer activity, while proximal NADH dehydrogenase activity remains unaffected . Similar comparative approaches can be applied to MT-ND4L variants.

Methodological Questions

  • What are the optimal storage and handling conditions for recombinant Formosania lacustre MT-ND4L?

Based on manufacturer recommendations for recombinant Formosania lacustre MT-ND4L:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles

  • Store working aliquots at 4°C for up to one week

Shelf life considerations:

  • Liquid form: approximately 6 months at -20°C/-80°C

  • Lyophilized form: approximately 12 months at -20°C/-80°C

Shelf life depends on multiple factors including:

  • Buffer composition

  • Storage temperature

  • The inherent stability of the protein itself

When working with this highly hydrophobic transmembrane protein, researchers should consider:

  • Using detergents or lipid nanoparticles to maintain solubility

  • Including stabilizers in storage buffers

  • Minimizing exposure to oxidizing conditions

  • Testing activity before experiments if stored for extended periods

  • What experimental approaches are most effective for studying MT-ND4L integration into Complex I?

Studying the integration of MT-ND4L into Complex I requires specialized techniques:

Structural approaches:

  • Cryo-electron microscopy of intact Complex I

  • Crosslinking mass spectrometry to identify interaction partners

  • Label transfer experiments to map proximity relationships

Functional approaches:

  • Blue native gel electrophoresis (BNGE) to analyze complex assembly states

  • In vitro import assays (for nuclear-encoded versions)

  • Pulse-chase experiments to track assembly kinetics

Genetic approaches:

  • RNA interference to deplete MT-ND4L and observe assembly intermediates

  • Site-directed mutagenesis to identify critical residues for assembly

  • Complementation studies in deficient cells

When investigating assembly, researchers should consider:

  • The temporal sequence of subunit integration

  • The role of assembly factors

  • Potential tissue-specific differences in assembly pathways

  • The impact of environmental factors on assembly efficiency

  • How can researchers effectively design experiments to study genetic variations in MT-ND4L across species?

Studying genetic variations in MT-ND4L across species requires careful experimental design:

Sequencing approaches:

  • When amplifying MT-ND4L from different species, design primers in conserved flanking regions

  • Consider complete mitochondrial genome sequencing rather than targeted approaches

  • For challenging templates, use techniques like Long Range PCR or capture-based enrichment

Comparative analysis framework:

  • Align sequences using specialized tools for highly divergent sequences

  • Consider codon usage and selection pressure (dN/dS ratios)

  • Analyze conservation patterns in functional domains

Functional validation:

  • Express variants from different species in model systems

  • Measure activity using standardized biochemical assays

  • Assess assembly efficiency in heterologous systems

In studying altitude adaptation, researchers identified specific SNPs and haplotypes in MT-ND4L that correlate with high-altitude adaptation in Tibetan yaks and cattle:

  • SNP m.10073C>T showed positive association with high-altitude adaptation (p < 0.0006)

  • Haplotype Ha1 in MT-ND4L showed positive association with high-altitude adaptability

  • Haplotype Ha3 showed negative association with this adaptability (p < 0.0017)

This approach combining genetic analysis with environmental adaptation provides valuable insights into functional variations across species.

  • What are the best approaches for expressing and purifying functional MT-ND4L for biochemical studies?

Expression and purification of functional MT-ND4L presents significant challenges due to its hydrophobic nature:

Expression systems:

  • E. coli is commonly used, as demonstrated with Formosania lacustre MT-ND4L

  • Consider specialized strains optimized for membrane protein expression

  • Evaluate eukaryotic expression systems for complex post-translational modifications

Fusion tags and constructs:

  • N-terminal 10xHis-tag has been successfully employed for Formosania lacustre MT-ND4L

  • Consider solubility-enhancing fusion partners

  • Evaluate the impact of tags on protein folding and function

Purification strategy:

  • Membrane isolation and solubilization with appropriate detergents

  • Affinity chromatography (IMAC for His-tagged constructs)

  • Size exclusion chromatography to ensure homogeneity

  • Validation of folding and activity

Functional validation methods:

  • Reconstitution into proteoliposomes

  • Electron transfer activity measurements

  • Binding studies with known interaction partners

When working with recombinant MT-ND4L, researchers should note that the E. coli expression system has been successfully used to produce full-length protein with an N-terminal 10xHis tag , though functional validation requires careful experimental design.

Table 1: Key Characteristics of Recombinant Formosania lacustre MT-ND4L

CharacteristicDetailsReference
Protein LengthFull length protein (116 amino acids)
Molecular Weight~11 kDa ,
SequenceMNLVISILAITIILSSILAVVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSIRF FLVAILFLLFDLEIALLLALPWGDQLYSATGTFFWATAVLILLTLGLIYEWTQGGLEWAE
Tag InformationN-terminal 10xHis-tagged
Expression Systemin vitro E. coli expression system
Storage Recommendation-20°C; for extended storage, -80°C
Shelf Life6 months (liquid form); 12 months (lyophilized) at -20°C/-80°C
Working StabilityStore working aliquots at 4°C for up to one week

Table 2: Significant MT-ND4L Variants and Their Associated Phenotypes

VariantNucleotide ChangeAmino Acid ChangeAssociated PhenotypeP-valueReference
rs28709356C>TNot specifiedAlzheimer's disease7.3 × 10⁻⁵
m.10073C>TC>TNot specifiedPositive association with high-altitude adaptation<0.0006
T10663CT>CVal65AlaLeber hereditary optic neuropathyNot specified
Haplotype Ha1Multiple variationsMultiplePositive association with high-altitude adaptability<0.0017
Haplotype Ha3Multiple variationsMultipleNegative association with high-altitude adaptability<0.0017

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.