Recombinant Fowlpox virus G-protein coupled receptor homolog FPV021 (FPV021)

Shipped with Ice Packs
In Stock

Description

Introduction to Fowlpox Virus and FPV021

Fowlpox virus is a double-stranded DNA virus and serves as the prototypical member of the Avipoxvirus genus . The virus naturally infects poultry species and has been utilized in vaccination strategies against fowlpox disease since the 1920s . With advancements in recombinant DNA technology during the 1980s, FPV found extensive application in the development of vaccine vectors against various poultry diseases . Over time, recombinant FPV (rFPV) has been investigated as a delivery vector for vaccines against human infectious diseases, notably HIV, and various cancers .

Within the complex genomic structure of Fowlpox virus lies the gene encoding FPV021, which produces a G-protein coupled receptor (GPCR) homolog protein. GPCRs constitute one of the largest and most diverse protein families in eukaryotes, serving crucial roles in signal transduction pathways. The presence of a GPCR homolog in the viral genome suggests potential mechanisms through which the virus might manipulate host cell signaling to facilitate viral replication and immune evasion.

Evolutionary Context

As a viral GPCR homolog, FPV021 likely originated through horizontal gene transfer from host organisms during the evolutionary history of Fowlpox virus. This phenomenon of viral acquisition of host genes is well-documented among large DNA viruses and represents a strategy to modulate host cellular responses. The conservation of FPV021 across different Fowlpox virus isolates suggests its importance in viral biology, although specific functional studies remain limited in the current literature.

Expression Systems and Purification

Recombinant FPV021 protein can be successfully expressed in prokaryotic systems, primarily Escherichia coli . The recombinant version typically includes a histidine (His) tag at the N-terminus to facilitate purification through affinity chromatography . This approach yields full-length protein (amino acids 1-320) that can be utilized for various research and potential diagnostic applications .

The production process typically results in a lyophilized powder form of the protein, which requires appropriate reconstitution before use . Specific buffer systems, commonly Tris/PBS-based buffer with 6% Trehalose at pH 8.0, are utilized to maintain protein stability and functionality during storage .

Protein Purity and Quality Assessment

Quality control measures ensure that recombinant FPV021 protein meets high standards for research applications. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) analysis typically demonstrates purity levels exceeding 90%, confirming the reliability of the expression and purification processes . Additional analytical techniques, including mass spectrometry and circular dichroism, may further validate protein identity and structural integrity.

Research Applications

Recombinant FPV021 protein serves valuable purposes in various research contexts:

  1. Antibody Production: The purified protein can be utilized to generate specific antibodies for detection and localization studies.

  2. Structure-Function Analysis: Biochemical and biophysical characterization of FPV021 can elucidate the structural basis for its potential interaction with host signaling molecules.

  3. Drug Discovery: As viral GPCRs represent potential therapeutic targets, recombinant FPV021 could facilitate screening of compounds that might interfere with viral-host interactions.

  4. Comparative Studies: Analysis of FPV021 in comparison with other viral and host GPCRs can provide evolutionary insights and reveal conserved functional mechanisms.

Vaccine Development Applications

The understanding of Fowlpox virus proteins, including FPV021, contributes to the broader knowledge base supporting the development of recombinant Fowlpox virus-based vaccines. These vaccines have shown promise for both veterinary and human applications due to several advantageous characteristics:

  1. Safety Profile: rFPV demonstrates abortive replication in mammalian cells, with protein expression peaking at 12-24 hours post-delivery and no detectable expression by 96 hours . This restricted replication profile contributes to the safety of rFPV-based vaccines.

  2. Localized Expression: Following intranasal delivery, rFPV expression remains confined to the initial vaccination site (lung and nasal cavity) without dissemination to distal sites or crossing the olfactory receptor neuron pathway .

  3. Limited Pre-existing Immunity: Unlike some viral vectors, rFPV shows minimal pre-existing immunity in humans due to its inability to replicate efficiently in mammalian cells .

Recent Advances in FPV021 Research

Recent studies of Fowlpox virus have primarily focused on its potential as a vaccine vector rather than detailed functional characterization of specific viral proteins like FPV021. A study published in 2024 examined the genetic diversity of Fowlpox virus isolates from chicken flocks in Egypt, revealing high nucleotide identity among various Egyptian isolates . While this research did not specifically focus on FPV021, it provides valuable context regarding the genetic conservation and diversity of Fowlpox viruses circulating in field conditions.

The broader research on Fowlpox virus has established its expression kinetics following vaccination. Studies using fluorescent protein markers have demonstrated that peak antigen expression occurs 12-24 hours post-vaccination, with no detectable viral gene expression by 96 hours . These findings have important implications for understanding the temporal dynamics of FPV021 expression in the context of viral infection or vaccination.

Technical Challenges and Opportunities

Emerging technologies such as cryo-electron microscopy and advanced mass spectrometry methods could facilitate detailed structural analysis of FPV021, potentially revealing binding sites for host ligands or interaction interfaces with intracellular signaling components. Such structural insights would significantly enhance understanding of the protein's functional mechanisms and potential as a therapeutic target.

Future Research Directions

Several promising research directions could significantly advance understanding of FPV021:

  1. Functional Characterization: Detailed studies of FPV021's signaling properties, including identification of potential ligands and downstream signaling pathways, would clarify its role in viral biology.

  2. Structure Determination: Resolving the three-dimensional structure of FPV021 would provide valuable insights into its functional mechanisms and facilitate structure-based drug design efforts.

  3. In Vivo Studies: Investigating the effects of FPV021 deletion or mutation on viral replication and pathogenesis could establish its significance in the viral life cycle.

  4. Comparative Analysis: Exploring homologs of FPV021 in related viruses could reveal evolutionary patterns and conserved functional domains across the Avipoxvirus genus.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in the manufacturing process.
Synonyms
FPV021; G-protein coupled receptor homolog FPV021
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV021
Target Protein Sequence
MDTDYGTVHTQQSVKGNTLILLIYFISFIVGFPGNCTVIWFTGYRWKKSVTTIWFLNLAI ADTLFVIFIPFEITYILMGHYWPFGLFVCRIGSLMFNTGMYASIFFLTFISIDRYCLAFR RDICNKYRYRINIMVMIIISWIISILLSTPYMYFKNTNEKYRNNRDCLEDYHSDNNTYLL RRVVFCISLVMRYLVPSVVMLFCYCLLLFKHSLFLSKGQTYTIVIMITSFMVLWTPYNIL YFIDVIGSHYYNADTIIDAAPISISLIFLSSSINPMIYMLVGRYVSFENYSMRESLKLIL SEERDNQTNHENEIKMENIN
Uniprot No.

Target Background

Database Links

KEGG: vg:1486740

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is the Fowlpox virus G-protein coupled receptor homolog FPV021?

FPV021 is a viral gene encoding a G-protein coupled receptor (GPCR) homolog found in the Fowlpox virus genome. Like other viral GPCRs, FPV021 likely evolved through horizontal gene transfer from host GPCR genes. The protein contains the characteristic seven-transmembrane domain structure typical of GPCRs. Viral GPCRs often mimic host receptors but with altered signaling properties that benefit viral replication and immune evasion. Within the context of the Fowlpox virus genome, FPV021 represents one of several genes that may modulate host cell signaling . Fowlpox virus, as a member of the Avipoxvirus genus, has a large DNA genome with multiple genes devoted to host interaction, including immune evasion strategies .

What methods are effective for isolating and propagating Fowlpox virus for FPV021 research?

Effective isolation and propagation of Fowlpox virus is critical for studying FPV021. The most reliable method involves inoculation of chorioallantoic membranes (CAMs) of embryonated chicken eggs (ECEs). This approach typically requires:

  • Collection of nodules or diphtheritic membranes from infected birds

  • Preparation of tissue homogenates (10-20% suspension in PBS with antibiotics)

  • Inoculation onto CAMs of 10-day-old ECEs from FPV-free hens

  • Incubation at 37°C for 5-7 days

  • Multiple passages (typically 3) to ensure virus propagation

This methodology has demonstrated high success rates, with studies showing progressive increase in positive isolation rates through successive passages (70% after first passage, increasing to 100% after third passage) . For confirmation of successful isolation, a combination of techniques including agar gel precipitation test (AGPT) and indirect fluorescent antibody test (IFAT) is recommended, with IFAT showing superior sensitivity (100% detection compared to 50-90% with AGPT) .

What expression systems are most suitable for recombinant FPV021 production?

For recombinant FPV021 production, several expression systems have been evaluated with varying efficacy:

Expression SystemAdvantagesLimitationsProtein Yield
E. coliLow cost, rapid growthLacks post-translational modifications0.5-2 mg/L
Insect cells (Sf9/Sf21)Proper protein folding, post-translational modificationsMore complex than bacterial systems5-10 mg/L
Chicken embryo fibroblastsNative cellular environmentLower yields, more labor-intensive0.1-0.5 mg/L
Mammalian cell linesMost authentic post-translational modificationsHighest cost, lower yields1-5 mg/L

For GPCR proteins like FPV021, insect cell expression systems using baculovirus vectors often provide the optimal balance between proper protein folding and yield . The methodology should include codon optimization for the expression system and incorporation of purification tags that minimally impact protein function. For viral GPCRs, N-terminal tags are generally preferred as C-terminal modifications may interfere with G-protein coupling .

How can researchers confirm the identity of isolated Fowlpox virus carrying the FPV021 gene?

Confirmation of FPV identity and FPV021 presence requires a multi-method approach:

  • Histopathological examination: Detection of characteristic eosinophilic intracytoplasmic inclusion bodies in infected tissues

  • Molecular confirmation: PCR amplification targeting specific viral genes. For FPV021 specifically, primers should be designed to amplify the gene region based on conserved sequences from reference genomes

  • Immunological methods:

    • AGPT using hyperimmune serum against standard FPV

    • IFAT using specific antibodies, which shows higher sensitivity (100%) compared to AGPT (50-90%)

  • Genomic sequencing: Whole-genome sequencing using next-generation sequencing technologies like Illumina or Nanopore provides definitive confirmation and allows strain identification through comparative genomic analysis with reference strains. This approach has shown high accuracy with nucleotide identity confirmation of 99.8% between direct tissue isolation and CAM-propagated virus .

What signaling pathways does FPV021 potentially modulate during infection?

As a viral GPCR homolog, FPV021 likely interfaces with host cell signaling pathways similar to mammalian GPCRs. Based on structural and functional analyses of other viral GPCRs, FPV021 may modulate:

  • cAMP signaling pathways: Viral GPCRs often alter cAMP levels, which can affect immune cell function. Studies of related viral GPCRs show they can either stimulate or inhibit adenylyl cyclase activity

  • Calcium signaling: Many viral GPCRs trigger calcium mobilization, affecting cell proliferation and viral replication. This typically occurs through Gαq coupling and phospholipase C activation

  • MAPK pathways: Activation of ERK1/2 signaling is common among viral GPCRs, promoting cell survival and proliferation beneficial for viral replication

  • NF-κB signaling: Potential modulation of this pathway may alter inflammatory responses and host antiviral mechanisms

Methodologically, these pathways can be investigated using:

  • Reporter gene assays with pathway-specific response elements

  • Phosphorylation-specific antibodies and Western blotting

  • Real-time calcium imaging in FPV021-expressing cells

  • Transcriptome analysis of cells expressing FPV021 compared to controls

Current research suggests that viral GPCRs like FPV021 often exhibit constitutive activity rather than requiring specific ligand binding, representing an adaptation that ensures consistent signaling modulation regardless of ligand availability .

How can CRISPR-Cas9 genome editing be utilized to study FPV021 function?

CRISPR-Cas9 technology offers powerful approaches for investigating FPV021 function through several strategies:

  • Gene knockout studies:

    • Design sgRNAs targeting conserved regions of FPV021

    • Generate FPV021-deficient recombinant viruses

    • Compare phenotypes (replication kinetics, pathogenicity, immune responses) between wildtype and knockout viruses

  • Domain-specific mutations:

    • Create precise mutations in key functional domains (e.g., G-protein binding sites, transmembrane regions)

    • Assess altered signaling properties using reporter assays

    • Evaluate impacts on viral fitness and host interaction

  • Promoter modification:

    • Alter FPV021 expression levels by modifying promoter elements

    • Create conditional expression systems to study temporal aspects of FPV021 function

  • Tagging for visualization:

    • Insert fluorescent protein tags for real-time imaging

    • Study protein localization and trafficking during infection

For effective implementation, homology-directed repair templates should be designed with approximately 800bp homology arms flanking the target site. The procedure requires established fowlpox virus reverse genetics systems, which have been successfully implemented for other poxvirus recombinant studies . The recombinant viruses can then be selected using fluorescent markers like GFP or mCherry as demonstrated in previous fowlpox recombinant studies .

What approaches can identify potential ligands for FPV021?

Identifying ligands for viral GPCRs like FPV021 requires systematic screening approaches:

  • In silico prediction:

    • Homology modeling of FPV021 structure based on crystallized GPCRs

    • Virtual screening of compound libraries against the predicted binding pocket

    • Molecular dynamics simulations to assess binding stability

  • Cell-based functional assays:

    • GPCR activation assays using GTPγS binding or reporter gene systems

    • High-throughput screening of candidate compounds or host-derived molecules

    • Measurement of second messenger production (cAMP, IP3, calcium)

  • Direct binding studies:

    • Radioligand binding assays with purified FPV021

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking studies with photoactivatable ligand analogs

  • Proteomic approaches:

    • Immunoprecipitation of FPV021 complexes from infected cells

    • Mass spectrometry identification of co-precipitated host factors

    • Validation of interactions using co-immunoprecipitation and FRET

Research on other viral GPCRs suggests that many have evolved to function constitutively or respond to widely available host factors rather than specific ligands, which represents an evolutionary advantage for the virus . The potential constitutive activity should be assessed by measuring baseline signaling in FPV021-expressing cells compared to controls with known constitutively active GPCRs as positive controls.

How does FPV021 contribute to immune evasion during fowlpox virus infection?

FPV021 likely plays significant roles in immune evasion through several mechanisms:

  • Chemokine signaling disruption:

    • May sequester host chemokines to prevent immune cell recruitment

    • Could potentially act as a chemokine receptor antagonist

  • Modulation of host cell apoptosis:

    • Activation of survival pathways through MAPK signaling

    • Interference with extrinsic apoptotic pathways triggered by immune effectors

  • Alteration of cytokine responses:

    • Potential interruption of interferon signaling pathways

    • Modulation of inflammatory cytokine production

  • Interference with antigen presentation:

    • Potential downregulation of MHC molecules through altered cellular trafficking

    • Disruption of dendritic cell maturation and function

These hypotheses can be tested through:

  • Comparative infection studies with wildtype versus FPV021-knockout viruses

  • Transcriptome and proteome analysis of infected host cells

  • Flow cytometry assessment of immune cell activation markers

  • Cytokine profiling during infection using multiplex assays

Understanding these mechanisms is particularly relevant considering that fowlpox virus has shown capability of integrating reticuloendotheliosis virus (REV) sequences, which has been associated with immunosuppressive effects in young chickens . The interaction between FPV021 and these integrated viral elements could represent a complex immune evasion strategy.

How can recombinant FPV021 be utilized in vaccine development strategies?

Recombinant FPV-based vaccines have demonstrated significant potential, with several approaches relevant to FPV021:

  • FPV021 as an immunomodulator:

    • Modification or deletion of FPV021 in vaccine vectors to reduce immunosuppressive effects

    • Enhanced immunogenicity through altered host-virus interactions

  • Targeting strategy:

    • Replacement of FPV021 with immunostimulatory molecules

    • Creation of chimeric proteins to direct immune responses

  • Vaccine vector optimization:

    • Insertion of heterologous antigens adjacent to or replacing FPV021

    • Promoter modifications to optimize antigen expression levels

  • Combination approaches:

    • Prime-boost strategies using modified FPV vectors lacking FPV021 immunomodulatory effects

    • Co-expression of antigens and immunostimulatory cytokines

Previous research has shown that fowlpox virus vectors can successfully express foreign antigens, with studies demonstrating that vaccinated chickens developed neutralizing antibodies more rapidly than unvaccinated controls following challenge . The efficacy of these recombinant vaccines depends significantly on the promoter used to drive expression, with strong synthetic promoters showing superior results compared to traditional promoters like the P7.5 promoter of vaccinia virus .

Construction of such recombinant viruses typically involves homologous recombination techniques, where cells infected with parent FPV are transfected with plasmids carrying the gene of interest flanked by FPV sequences to direct insertion . Selection of recombinants can be achieved using fluorescent markers like GFP or mCherry, followed by multiple rounds of plaque purification .

What are the optimal parameters for genomic analysis of FPV021 variants?

Comprehensive genomic analysis of FPV021 variants requires careful consideration of several parameters:

  • Sequencing approach:

    • Direct sequencing from clinical specimens avoids potential genome modifications associated with in vitro culturing

    • Combination of Illumina (high accuracy) and Nanopore (long reads) sequencing technologies provides optimal results

    • Map-to-reference approach using previously sequenced FPV genomes as templates has proven effective

  • Polymorphism analysis:

    • Detailed SNP detection to identify strain variations

    • Comparison with reference genomes for accurate strain identification

    • Assessment of nucleotide identity percentages (optimal cutoffs >98.5% for strain discrimination)

  • Phylogenetic analysis:

    • Multiple sequence alignment of FPV021 sequences from different isolates

    • Maximum likelihood or Bayesian inference methods with appropriate evolutionary models

    • Bootstrap analysis (minimum 1000 replicates) to ensure robust clade support

  • Recombination detection:

    • Screening for potential recombination events within FPV021

    • Analysis of selection pressures using dN/dS ratios

    • Assessment of potential horizontal gene transfer events

When analyzing FPV genomes, it's important to consider that field isolates may carry integrated reticuloendotheliosis virus (REV) sequences that can affect virulence and immunosuppressive properties . These integrated elements should be accounted for when analyzing the genomic context of FPV021.

What controls are essential for FPV021 functional studies?

Robust experimental design for FPV021 functional studies requires careful implementation of multiple controls:

  • Genetic controls:

    • FPV021-knockout virus (negative control)

    • FPV021 complementation virus (rescue control)

    • Point mutants affecting specific functional domains (specificity controls)

  • Expression controls:

    • Western blot verification of protein expression levels

    • Immunofluorescence confirmation of proper subcellular localization

    • RT-qPCR quantification of transcript levels

  • Functional assays controls:

    • Known GPCR agonists/antagonists as positive/negative controls

    • Constitutively active and inactive GPCR variants

    • G-protein coupling inhibitors to confirm signaling specificity

  • In vivo controls:

    • Age-matched uninfected animals

    • Animals infected with wildtype virus versus FPV021-modified virus

    • Vaccination with control antigens to establish baseline protection levels

When conducting vaccination studies using FPV-based vectors, it's essential to include groups receiving different promoter constructs, as promoter strength has been shown to significantly impact antigen expression levels and subsequent immune responses . Additionally, studies should include controls for potential immunomodulatory effects of FPV021 itself, independent of any inserted foreign antigens.

What challenges arise in crystallization of viral GPCRs like FPV021?

Crystallization of GPCRs, including viral homologs like FPV021, presents several technical challenges:

  • Protein stability issues:

    • GPCRs are inherently unstable when extracted from membranes

    • Solution: Use thermostabilizing mutations identified through alanine scanning mutagenesis

    • Implementation of lipidic cubic phase crystallization methods

  • Conformational heterogeneity:

    • GPCRs exist in multiple conformational states in equilibrium

    • Strategy: Use of conformation-specific antibodies or nanobodies to stabilize specific states

    • Incorporation of fusion proteins (e.g., T4 lysozyme) to enhance crystal contacts

  • Expression and purification challenges:

    • Low expression levels in heterologous systems

    • Approach: Optimized expression in insect cells with baculovirus vectors

    • Use of GFP fusion constructs to monitor expression and folding

  • Detergent selection:

    • Critical for maintaining protein stability and activity

    • Methodology: Systematic screening of detergents using thermal stability assays

    • Implementation of novel amphipathic agents like maltose-neopentyl glycol

The most successful approach typically involves a combination of these strategies, with recent advances in cryo-electron microscopy offering alternative structural determination methods that may overcome some of the limitations of crystallography for membrane proteins like FPV021 .

How can researchers address data contradictions in FPV021 signaling studies?

Contradictory results in viral GPCR signaling studies are common and require systematic approaches to resolution:

  • Standardization of experimental systems:

    • Use consistent cell backgrounds across studies

    • Quantify receptor expression levels to normalize signaling outputs

    • Employ multiple detection methods for each signaling pathway

  • Context-dependent signaling analysis:

    • Evaluate signaling in both homologous (avian) and heterologous cell systems

    • Examine signaling during actual viral infection versus isolated expression

    • Consider temporal aspects of signaling during the viral life cycle

  • Biased signaling investigations:

    • Assess potential signaling bias toward specific G-protein subtypes

    • Evaluate β-arrestin recruitment independently from G-protein activation

    • Consider the impact of receptor oligomerization on signaling outputs

  • Replication and validation:

    • Independent verification by multiple laboratories

    • Use of complementary assay technologies (BRET, FRET, impedance, DMR)

    • Verification with both gain-of-function and loss-of-function approaches

When interpreting contradictory results, consider that viral GPCRs often evolve unique signaling properties that may not conform to classical GPCR paradigms established for mammalian receptors . Additionally, the presence of integrated viral elements like REV in some fowlpox strains may impact signaling studies if not properly controlled for .

What are the most common pitfalls in recombinant FPV vector construction?

Development of recombinant FPV vectors containing modified FPV021 or heterologous genes faces several technical challenges:

  • Genetic instability issues:

    • Large or repetitive inserts may be unstable during virus passage

    • Solution: Use homologous recombination with flanking regions >500bp

    • Implement multiple plaque purifications (minimum 3-4 rounds)

  • Selection and screening challenges:

    • Difficult identification of recombinants without clear phenotypic markers

    • Approach: Incorporation of fluorescent proteins (GFP, mCherry) for visual selection

    • Use of antibiotic resistance markers (e.g., blasticidin S) for additional selection pressure

  • Expression optimization:

    • Promoter strength variations significantly impact expression levels

    • Strategy: Comparative analysis of different promoters (synthetic vs. native)

    • Testing of both early/late and synthetic promoters for optimal expression

  • Genomic location effects:

    • Insertion site can affect both transgene expression and virus fitness

    • Methodology: Evaluation of multiple genomic locations using systematic approaches

    • Consider intergenic regions that minimize disruption of essential viral functions

The construction process typically requires primary chicken embryo skin cells for transfection/infection, with recombinant viruses isolated after multiple rounds of plaque purification under selection . Success rates vary significantly based on insert size and location, with smaller inserts (<2kb) generally showing higher stability.

What emerging technologies will advance FPV021 research?

Several cutting-edge technologies promise to enhance understanding of FPV021 function:

  • Cryo-electron microscopy: Enabling structural determination without crystallization, particularly valuable for membrane proteins like GPCRs

  • Single-cell transcriptomics: Providing insights into cell-specific responses to FPV021 signaling during infection

  • CRISPR-Cas9 screening: Facilitating identification of host factors interacting with FPV021 through genome-wide knockout approaches

  • Nanobody development: Creating conformation-specific probes to study FPV021 activation states

  • Synthetic biology approaches: Engineering chimeric receptors combining domains from FPV021 with mammalian GPCRs to dissect specific functions

The field would benefit significantly from comprehensive comparative studies between FPV021 and other viral GPCRs to identify conserved mechanisms of host manipulation. Future research should also focus on translating basic FPV021 biology into improved vaccine vectors through targeted modifications enhancing immunogenicity while reducing potential immunomodulatory effects.

How might FPV021 research impact broader viral immunology understanding?

Research on FPV021 has potential to advance several areas of viral immunology:

  • Viral immunomodulation mechanisms: Revealing how viruses manipulate host signaling through GPCR mimicry

  • Evolution of viral immune evasion: Providing insights into convergent strategies across different viral families

  • Vaccine vector optimization: Informing rational design of recombinant viral vectors with enhanced immunogenicity

  • Host-pathogen interface: Illuminating fundamental aspects of how viruses interface with cellular communication networks

  • Viral adaptation: Enhancing understanding of how viruses acquire and adapt host genes for their benefit

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.