Recombinant Fowlpox virus G-protein coupled receptor homolog FPV027 (FPV027)

Shipped with Ice Packs
In Stock

Description

Functional and Biological Insights

FPV027 belongs to a family of viral GPCRs that may play roles in immune evasion or host-cell interactions. Key findings include:

2.1. Homology and Evolutionary Context

  • Chemokine Receptor Homology: FPV027 shares sequence similarity with mammalian chemokine receptors, particularly those in primates . This suggests potential mimicry of host signaling pathways.

  • Immune Modulation: Fowlpox virus encodes multiple immune-evasion proteins, including GPCRs like FPV027, which may interfere with host chemokine signaling to suppress antiviral responses .

2.2. Viral Genome Organization

FPV027 is part of the fowlpox virus genome, which contains three GPCR homologs (FPV021, FPV027, and FPV031). These genes are clustered in regions associated with host-range adaptation and viral persistence .

Production and Biochemical Properties

FPV027 is produced as a recombinant protein for research purposes. Key parameters include:

ParameterDetailsSource
Expression HostE. coli (partial or full-length variants)
TagN-terminal His-tag (full-length)
Storage Conditions- Lyophilized: 12 months at -20°C/-80°C
- Liquid: 6 months at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50% final concentration)

**4.1. Antigen for Serological Assays

FPV027 is used in ELISA kits to detect anti-fowlpox virus antibodies. These assays rely on recombinant protein-coated plates to measure humoral immune responses .

**4.2. Studying Viral-Host Interactions

  • Immune Evasion Studies: FPV027’s homology to chemokine receptors makes it a candidate for investigating viral strategies to disrupt host chemokine signaling .

  • Vaccine Development: While not directly linked to FPV027, fowlpox-based vaccines (e.g., rFPV-S1/IL18) highlight the broader utility of recombinant fowlpox proteins in poultry immunology .

Challenges and Limitations

  • Structural Elucidation: The absence of 3D structural data hinders mechanistic studies of FPV027’s receptor binding or signaling .

  • Functional Redundancy: Overlapping roles with other fowlpox GPCRs (FPV021, FPV031) complicate interpretation of FPV027-specific effects .

Product Specs

Form
Lyophilized powder
Note: We typically ship the format that is currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your location and the purchasing method. Please contact your local distributor for the most accurate delivery timeframe.
Note: Our standard shipping method includes blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
FPV027; G-protein coupled receptor homolog FPV027
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Fowlpox virus (strain NVSL) (FPV)
Target Names
FPV027
Target Protein Sequence
MSMNNITSKMNQDSYGYFQLHMSDFTRVSLSIVFTLVFLVGIIGNAVIIWFIGFKWTKTI STLLFINLALADSLFLIFIPVYTVYVLSNFHWYLGEFLCRVSSFFFTTNMYASMFLLTFI SIDKYLTLTSHRLVYKYRKYRNYYVCIGAIWCISIALGVPTLYYKRVILSSSRNETRCIS YYGDDKHTAITIYRIIVCIRFIIGYVFPMTVILLSYALIVYKVKFINKPPNRSFMITTAS IFVFLACWTPHHVLNIISLYGLKSTSMYNYIKESIPFVNAIAFVYSAINPIIYIFVIRLT STYDSDTMDELRSALLDEETTSTEDCSDIEISDISR
Uniprot No.

Target Background

Database Links

KEGG: vg:1486746

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What is FPV027 and what is its biological significance?

FPV027 is a G-protein coupled receptor homolog encoded by the Fowlpox virus genome. It belongs to the family of viral G-protein coupled receptors (vGPCRs) that play important roles in viral pathogenesis. While specific information about FPV027 is limited in the current literature, viral GPCRs generally function to modulate host immune responses and facilitate viral replication and spread. By mimicking host GPCRs, these viral proteins can hijack cellular signaling pathways, potentially contributing to immune evasion strategies employed by the virus.

Similar to other poxvirus proteins like the IL-18 binding proteins (IL-18bp) that have been identified in Fowlpox virus (FPV214 rather than FPV073), FPV027 likely evolved to manipulate host responses . Understanding FPV027's function provides insights into fowlpox virus pathogenesis and potential targets for antiviral interventions.

How does FPV027 compare structurally to other viral G-protein coupled receptors?

FPV027 shares structural homology with mammalian GPCRs, characterized by seven transmembrane domains connected by intracellular and extracellular loops. While detailed structural information specific to FPV027 is not extensively documented in the literature, comparative sequence analysis with other viral GPCRs suggests conservation of key functional domains.

When studying FPV027, researchers should consider:

  • The presence of conserved motifs typical of GPCRs

  • Potential ligand binding sites in extracellular domains

  • Intracellular regions responsible for G-protein coupling

  • Post-translational modifications that affect receptor function

Structural prediction algorithms and homology modeling based on known GPCR structures provide valuable starting points for understanding FPV027's potential function before experimental verification.

What expression systems are most effective for producing recombinant FPV027?

The selection of an appropriate expression system is critical for obtaining functional recombinant FPV027. Based on experiences with similar viral membrane proteins, several systems warrant consideration:

  • Prokaryotic expression systems: While cost-effective and scalable, these systems often produce incorrectly folded viral membrane proteins and lack appropriate post-translational modifications.

  • Yeast expression systems: Provide eukaryotic protein processing capabilities while maintaining relative simplicity.

  • Insect cell expression systems: Often preferred for viral membrane proteins, as they offer proper folding and post-translational modifications.

  • Mammalian cell expression systems: Provide the most native-like environment for expression of viral GPCRs.

Fowlpox virus proteins have been successfully expressed in chicken embryo fibroblasts (CEFs), as demonstrated in the production of recombinant fowlpox virus vaccines like fpIBD1 . When expressing FPV027, special consideration should be given to the inclusion of affinity tags for purification while minimizing interference with protein function.

What are the most effective methodological approaches for studying FPV027 functionality?

Investigating FPV027 functionality requires multiple complementary approaches:

Genetic Approaches:

  • CRISPR/Cas9-mediated gene editing to create FPV027 knockouts

  • Site-directed mutagenesis to identify functional domains

  • Generation of chimeric receptors to pinpoint ligand-binding regions

Biochemical and Biophysical Approaches:

  • Ligand binding assays using potential host molecules

  • Receptor signaling assays monitoring G-protein activation

  • Protein-protein interaction studies using proximity labeling techniques

Cellular and Immunological Approaches:

  • Impact of FPV027 expression on host cell signaling pathways

  • Effects on immune cell recruitment and activation

  • Influence on cytokine production and inflammatory responses

When studying viral GPCRs like FPV027, it's important to consider the viral life cycle context. Similar to studies with other Fowlpox virus proteins, researchers should evaluate how FPV027 functions within infected cells and its potential interactions with host immune components like interleukins .

How can FPV027 be utilized in recombinant fowlpox virus vaccine development?

Fowlpox virus has emerged as a valuable viral vector for vaccine development due to its large genome capacity, ability to accommodate multiple foreign genes, and established production methods. Recombinant FPV vaccines have successfully expressed protective antigens from various poultry pathogens .

When considering FPV027's role in vaccine development:

  • As a target for attenuation: Modification or deletion of FPV027 might reduce virulence while maintaining immunogenicity, similar to how researchers have targeted other Fowlpox virus ORFs like FPV073 and FPV214 .

  • As an adjuvant candidate: If FPV027 modulates immune responses, it could potentially enhance vaccine efficacy when co-expressed with target antigens.

  • As a fusion partner: FPV027 could be used to create fusion proteins with heterologous antigens to enhance immunogenicity.

The methodology for incorporating FPV027 modifications into recombinant vaccines would follow established protocols for fowlpox vector development, including transfection of infected chicken embryo fibroblasts with recombinant plasmids containing the desired genetic constructs .

What analytical techniques are most suitable for characterizing FPV027 protein-ligand interactions?

Characterizing FPV027's interactions with potential ligands requires sophisticated analytical approaches:

Biophysical Methods:

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Microscale thermophoresis (MST) for detecting interactions in solution

  • Nuclear magnetic resonance (NMR) spectroscopy for mapping binding interfaces

Structural Methods:

  • X-ray crystallography of FPV027 alone and in complex with ligands

  • Cryo-electron microscopy for larger complexes

  • Molecular dynamics simulations to predict binding modes

Cellular Methods:

  • BRET/FRET-based assays to monitor receptor activation in live cells

  • Calcium flux assays if FPV027 couples to Gq proteins

  • Cyclic AMP assays if FPV027 couples to Gs/Gi proteins

For membrane proteins like FPV027, special consideration must be given to maintaining the native conformation during purification and analysis, often requiring detergent solubilization or reconstitution into lipid nanodiscs or liposomes.

What are the key considerations when designing experiments to evaluate FPV027's role in viral pathogenesis?

Experimental design for studying FPV027's role in pathogenesis should address multiple aspects:

In Vitro Studies:

  • Comparison of wild-type and FPV027-knockout virus replication in relevant cell types

  • Evaluation of cytopathic effects and cell-to-cell spread

  • Analysis of host cell signaling pathway modulation

  • Measurement of immune response modulation (cytokine production, immune cell activation)

Ex Vivo Studies:

  • Infection of primary chicken immune cells to assess immunomodulatory effects

  • Organ culture models to evaluate tissue tropism and damage

In Vivo Studies:

  • Challenge models comparing wild-type and FPV027-modified viruses

  • Evaluation of viral load, tissue distribution, and clinical signs

  • Assessment of humoral and cellular immune responses

  • Detailed pathological examinations

When designing these experiments, researchers should consider using approaches similar to those employed in studies of recombinant fowlpox vaccines expressing glycoprotein B of infectious laryngotracheitis virus, where specific immune parameters like antibody levels, CD4+/CD8+ T-cell ratios, and protection efficacy were systematically evaluated .

What challenges are encountered when crystallizing FPV027 for structural studies?

Crystallizing membrane proteins like FPV027 presents several significant challenges:

  • Protein purification complexities: Membrane proteins require detergents for extraction from membranes, which can interfere with crystallization.

  • Conformational heterogeneity: GPCRs exist in multiple conformational states, leading to sample heterogeneity that impedes crystal formation.

  • Post-translational modifications: These can create additional heterogeneity in the protein sample.

  • Crystal packing limitations: The hydrophobic transmembrane regions limit potential crystal contacts.

Methodological approaches to overcome these challenges include:

  • Use of fusion partners to increase solubility (e.g., T4 lysozyme inserted into one of the intracellular loops)

  • Antibody fragment co-crystallization to stabilize specific conformations

  • Lipidic cubic phase crystallization, which provides a membrane-like environment

  • Thermostabilizing mutations to lock the receptor in specific conformations

  • Nanobody co-crystallization to reduce conformational flexibility

How can researchers overcome challenges in studying protein-protein interactions involving FPV027?

Investigating FPV027's interactions with host and viral proteins requires specialized approaches:

Membrane-Compatible Methods:

  • Split-ubiquitin yeast two-hybrid systems adapted for membrane proteins

  • MYTH (Membrane Yeast Two-Hybrid) assays

  • Proximity-dependent biotin identification (BioID) in relevant cell types

  • APEX2-based proximity labeling

Biochemical Approaches:

  • Co-immunoprecipitation with appropriate detergent conditions

  • Cross-linking mass spectrometry to capture transient interactions

  • Label-free quantitative proteomics comparing wild-type and FPV027-knockout viruses

Imaging Approaches:

  • Fluorescence resonance energy transfer (FRET) microscopy

  • Bimolecular fluorescence complementation (BiFC)

  • Super-resolution microscopy to visualize co-localization at nanoscale resolution

When studying FPV027 interactions, researchers should consider both direct binding partners and downstream effectors that may be part of larger signaling complexes.

How does FPV027 compare functionally to GPCRs encoded by other poxviruses?

Comparative analysis of FPV027 with other poxvirus GPCRs provides valuable insights:

VirusGPCR HomologKnown FunctionsSignaling PathwaysHost Range
Fowlpox virusFPV027Under investigationTo be determinedAvian species
Vaccinia virusVarious ORFsImmune modulationMultiple G-protein-mediated pathwaysBroad
Molluscum contagiosumMC80RChemokine receptor homologPotential antagonist of CCR8Humans
Swinepox virusSPV030Chemokine bindingInhibits leukocyte recruitmentSwine

Functional characterization of FPV027 should include:

  • Sequence-based phylogenetic analysis with other viral GPCRs

  • Comparison of ligand specificity and binding affinities

  • Analysis of signaling pathway activation patterns

  • Evaluation of species-specific activity differences

This comparative approach leverages knowledge from better-characterized viral GPCRs to guide hypotheses about FPV027's function.

What are the implications of FPV027 research for developing novel antiviral strategies?

Understanding FPV027 function opens several avenues for antiviral development:

  • Direct targeting of FPV027: Small molecule antagonists designed to block receptor function could inhibit viral replication if FPV027 plays an essential role.

  • Disruption of FPV027-mediated signaling: Compounds that interfere with downstream signaling events activated by FPV027 could limit viral pathogenesis.

  • Vaccine development: Modified fowlpox vectors with altered FPV027 could serve as attenuated vaccines or vectors for expressing heterologous antigens, similar to how researchers have developed recombinant fowlpox virus vaccines for other poultry pathogens .

  • Broad-spectrum strategies: Identifying conserved functional mechanisms among viral GPCRs could lead to broad-spectrum antivirals effective against multiple poxviruses.

Research methodologies should include high-throughput screening approaches, structure-based drug design, and in vivo testing of candidate compounds in appropriate challenge models.

How can advanced genetic engineering approaches enhance FPV027 research?

Modern genetic tools offer powerful approaches for FPV027 research:

CRISPR/Cas9 Technologies:

  • Generation of precise viral mutants for functional studies

  • Creation of reporter viruses to monitor FPV027 expression

  • Development of cell lines with modified potential interaction partners

Synthetic Biology Approaches:

  • Construction of chimeric GPCRs to map functional domains

  • Design of orthogonal signaling systems to study pathway specificity

  • Engineering of fowlpox virus vectors with modified FPV027 for vaccine applications

Advanced Imaging Methods:

  • Super-resolution microscopy to track FPV027 localization during infection

  • Live-cell imaging with genetically encoded sensors to monitor signaling events

  • Correlative light and electron microscopy to link function to ultrastructure

These approaches can build upon established methodologies for recombinant fowlpox virus engineering, where techniques for gene insertion, deletion, and functional assessment have been developed . For example, researchers have successfully created recombinant fowlpox viruses with multiple genetic modifications, including deletion of specific viral genes and insertion of heterologous genes under appropriate promoter control .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.